ALDOC antibody

• Catalog number
  70R-2334
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Proteases, Inhibitors, & Enzymes
• Type of Immunogen
  ALDOC antibodies were raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
• Raised in
  Rabbit
• Specificity
  ALDOC antibody was raised against the N terminal of ALDOC
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDOC antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 0.5 ug/ml
• Assay Information
  ALDOC Blocking Peptide, catalog no. 33R-6286, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody
• Additional Information
  This is a rabbit polyclonal antibody against ALDOC, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ALDOC  
• Gene symbol
  ALDOC
• Short name
  ALDOC antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal ALDOC antibody raised against the N terminal of ALDOC
• Alternative technique
  antibodies
• Alternative to gene target
  aldolase C, fructose-bisphosphate, ALDC, ALDOC and IDBG-36924 and ENSG00000109107 and 230, cytoskeletal protein binding, Cytoplasm, Aldoc and IDBG-202678 and ENSMUSG00000017390 and 11676, ALDOC and IDBG-631697 and ENSBTAG00000013099 and 504584

Gene info

• Identity
  HGNC:418
• Gene
  ALDOC
• Long gene name
  aldolase, fructose-bisphosphate C
• Synonyms gene name
  • aldolase C, fructose-bisphosphate
• GenBank acession
  • AF054987
• Locus
  17q11.2
• Discovery year
  1986-01-01
• Entrez gene record
  230
• Classification
  • Aldolases
  • Endoribonucleases
• VEGA ID
  OTTHUMG00000132605

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products