Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human C C Motif Chemokine 8 CCL8 MCP 2

Recombinant Human C C Motif Chemokine 8 CCL8 MCP 2 is available 8 times from Novo labs

C063-1000 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 size: 1 mg | 2,518.38 USD

Catalog number C063-1000
Supplier novo
Price 2,518.38 USD
Size 1 mg
Description Recombinant Human C-C Motif Chemokine 8 is produced by our E.coli expression system and the target gene encoding Gln24-Pro99 is expressed.
Origin Escherichia coli
Peptide sequence QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Estimated molecular weight 8,9 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Gene targetC-C Motif Chemokine 8/CCL8/MCP-2
Short name Recombinant C-C Motif Chemokine 8/CCL8/MCP-2
Alternative name recombinant H. sapiens C-C Motif Chemokine 8/chemokine (C-C motif) ligand 8/MCP-2
1. Gene info
Identity 10635
Gene CCL8
Long gene name C-C motif chemokine ligand 8
Synonyms gene
  • SCYA8
Synonyms gene name
  • small inducible cytokine subfamily A (Cys-Cys), member 8 (monocyte chemotactic protein 2)
  • chemokine (C-C motif) ligand 8
Synonyms
  • MCP-2
  • HC14
GenBank acession
  • X99886
Locus 17q12
Discovery year 1996-11-14
Entrez gene record 6355
Pubmed identfication
  • 9119400
RefSeq identity
  • NM_005623
Classification
  • Chemokine ligands
  • Endogenous ligands
Havana BLAST/BLAT OTTHUMG00000132883
2. Gene info
Identity 14013
Gene SMC4
Long gene name structural maintenance of chromosomes 4
Synonyms gene
  • SMC4L1
Synonyms gene name
  • SMC4 (structural maintenance of chromosomes 4, yeast)-like 1
  • SMC4 structural maintenance of chromosomes 4-like 1 (yeast)
Synonyms
  • hCAP-C
  • CAP-C
GenBank acession
  • AF092564
Locus 3q25.33
Discovery year 2001-02-22
Entrez gene record 10051
Pubmed identfication
  • 9789013
  • 10319587
Classification
  • Structural maintenance of chromosomes proteins
  • Condensin I subunits
  • Condensin II subunits
Havana BLAST/BLAT OTTHUMG00000159006
3. Gene info
Identity 1604
Gene CCR3
Long gene name C-C motif chemokine receptor 3
Synonyms gene
  • CMKBR3
Synonyms gene name
  • chemokine (C-C motif) receptor 3
Synonyms
  • CC-CKR-3
  • CKR3
  • CD193
GenBank acession
  • AF247361
Locus 3p21.31
Discovery year 1995-05-30
Entrez gene record 1232
Classification
  • CD molecules
  • C-C motif chemokine receptors
Havana BLAST/BLAT OTTHUMG00000133484
MeSH Data
Name Primary Cell Culture
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C063-10 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 size: 10 ug | 223.93 USD

Loading

C063-50 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 size: 50 ug | 548.24 USD

Loading

C063-500 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 size: 500 ug | 1,780.40 USD

Loading

CC95-1000 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His) size: 1 mg | 2,518.38 USD

Loading

CC95-10 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His) size: 10 ug | 162.16 USD

Loading

CC95-50 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His) size: 50 ug | 375.05 USD

Loading

CC95-500 | Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His) size: 500 ug | 1,780.40 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P80075
Description Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Species Human
Alternative technique rec
Alternative to gene target chemokine (C-C motif) ligand 8, HC14 and MCP-2 and MCP2 and SCYA10 and SCYA8, CCL8 and IDBG-40686 and ENSG00000108700 and 6355, phospholipase activator activity, Extracellular, CCL8 and IDBG-630945 and ENSBTAG00000014113 and 281044,788169
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 size: 1 m
Filters
+32-(0)1-658-90-45 [email protected]
  • C-C
  • Motif
  • Chemokine
  • 8/CCL8/MCP-2
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee