Rabbit PODXL antibody
-
Catalog number70R-6251
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDifferentiation & Development
-
ImmunogenPODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
-
SpecificityPODXL antibody was raised against the middle region of PODXL
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PODXL antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPODXL
-
Short nameRabbit PODXL antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PODXL antibody raised against the middle region of PODXL
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetpodocalyxin-like, Gp200 and PC and PCLP and PCLP-1, PODXL and IDBG-41798 and ENSG00000128567 and 5420, protein binding, Extracellular, Podxl and IDBG-133888 and ENSMUSG00000025608 and 27205, PODXL and IDBG-635552 and ENSBTAG00000010452 and 616366
-
Gene info
-
Identity
-
Gene
-
Long gene namepodocalyxin like
-
Synonyms gene name
- podocalyxin-like
-
Synonyms
-
Locus
-
Discovery year1997-07-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data