Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human a Amylase 2B AMY2B C 6His

Recombinant Human a Amylase 2B AMY2B C 6His is available 4 times from Novo labs

CI36-1000 | Recombinant Human a-Amylase 2B/AMY2B (C-6His) size: 1 mg | 2,767.91 USD

Loading

CI36-500 | Recombinant Human a-Amylase 2B/AMY2B (C-6His) size: 500 ug | 1,956.81 USD

Loading

CI36-10 | Recombinant Human a-Amylase 2B/AMY2B (C-6His) size: 10 ug | 178.22 USD

Loading

CI36-50 | Recombinant Human a-Amylase 2B/AMY2B (C-6His) size: 50 ug | 368.57 USD

Loading
Description Recombinant Human alpha-amylase 2B is produced by our Mammalian expression system and the target gene encoding Gln16-Leu511 is expressed with a 6His tag at the C-terminus.
Species reactivity Human
Peptide sequence QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH
Estimated molecular weight 56,9 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Dry Ice/ice packs
Package form Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P19961
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targeta-Amylase 2B/AMY2B C-6His
Short name Recombinant a-Amylase 2B/AMY2B (C-6His)
Technique Recombinant
Species Human
Alternative name Human alpha-amylase 2B/AMY2B(C-6His)
Alternative technique rec
Similar products
TMEM120B shRNA Plasmid Suppplier: MyBioSource
Price: 784.42 USD
Mouse 6Ckine ELISA kit Suppplier: bioaim scientific
Price: 641.36 USD
MYO1C siRNA (Rat) Suppplier: MyBioSource
Price: 549.22 USD
Bovine ponticulin ELISA Kit Suppplier: Enlibio
Price: 543.16 USD
PHYH Antibody ALEXA FLUOR Suppplier: Bioss Primary Conjugated Antibodies. ALEXA FLUOR
Price: 460.71 USD
PD-L1 Suppplier: EnoGene
Price: 454.65 USD
IGF2R (Ab-2409) Primary Antibody Suppplier: EnoGene
Price: 454.65 USD
GJB6 antibody - middle region Suppplier: aviva
Price: 379.48 USD
Phospho Smad2 S250 Polyclonal Antibody Suppplier: BT-Laboratory
Price: 324.92 USD
Goat Anti Rhesus IgG H Suppplier: MBS Polyclonals
Price: 227.93 USD
CDH1 Recombinant Protein Suppplier: aviva
Price: 223.08 USD
Chicken aryl sulfatase A ELISA Kit Suppplier: MyBioSource
Price: 6.06 USD
Recombinant Human CD37 Suppplier: MyBioSource
Price: 6.06 USD
Human Astrotactin ELISA kit Suppplier: BlueGen ELISAs
Price: 1 539.75 USD
Ask
Ajax processing
Close
Recombinant Human a Amylase 2B AMY2B C 6His - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • a-Amylase
  • 2B/AMY2B
  • C-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee