Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human C C Motif Chemokine 16 CCL16

Recombinant Human C C Motif Chemokine 16 CCL16 is available 4 times from Novo labs

C064-10 | Recombinant Human C-C Motif Chemokine 16/CCL16 size: 10 ug | 191.46 USD

Loading

C064-500 | Recombinant Human C-C Motif Chemokine 16/CCL16 size: 500 ug | 1,828.50 USD

Loading

C064-50 | Recombinant Human C-C Motif Chemokine 16/CCL16 size: 50 ug | 459.96 USD

Loading

C064-1000 | Recombinant Human C-C Motif Chemokine 16/CCL16 size: 1 mg | 2,586.41 USD

Catalog number C064-1000
Supplier novo
Price 2,586.41 USD
Size 1 mg
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 10614
Gene CCL16
Long gene name C-C motif chemokine ligand 16
Synonyms gene
  • SCYA16
Synonyms gene name
  • small inducible cytokine subfamily A (Cys-Cys), member 16
  • chemokine (C-C motif) ligand 16
Synonyms
  • NCC-4
  • SCYL4
  • LEC
  • HCC-4
  • LMC
  • LCC-1
  • CKb12
  • Mtn-1
GenBank acession
  • AB007454
Locus 17q12
Discovery year 1997-02-11
Entrez gene record 6360
Pubmed identfication
  • 8661057
RefSeq identity
  • NM_004590
Classification
  • Chemokine ligands
Havana BLAST/BLAT OTTHUMG00000188402
2. Gene info
Identity 14013
Gene SMC4
Long gene name structural maintenance of chromosomes 4
Synonyms gene
  • SMC4L1
Synonyms gene name
  • SMC4 (structural maintenance of chromosomes 4, yeast)-like 1
  • SMC4 structural maintenance of chromosomes 4-like 1 (yeast)
Synonyms
  • hCAP-C
  • CAP-C
GenBank acession
  • AF092564
Locus 3q25.33
Discovery year 2001-02-22
Entrez gene record 10051
Pubmed identfication
  • 9789013
  • 10319587
Classification
  • Condensin I subunits
  • Condensin II subunits
  • Structural maintenance of chromosomes proteins
  • MicroRNA protein coding host genes
Havana BLAST/BLAT OTTHUMG00000159006
3. Gene info
Identity 1604
Gene CCR3
Long gene name C-C motif chemokine receptor 3
Synonyms gene
  • CMKBR3
Synonyms gene name
  • chemokine (C-C motif) receptor 3
Synonyms
  • CC-CKR-3
  • CKR3
  • CD193
GenBank acession
  • AF247361
Locus 3p21.31
Discovery year 1995-05-30
Entrez gene record 1232
Classification
  • C-C motif chemokine receptors
  • CD molecules
Havana BLAST/BLAT OTTHUMG00000133484
Product images
    #Human#.jpg
Description Recombinant Human C-C Motif Chemokine 16 is produced by our E.coli expression system and the target gene encoding Gln24-Gln120 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Estimated molecular weight 11 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number O15467
Additional description Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetC-C Motif Chemokine 16/CCL16
Short name Recombinant C-C Motif Chemokine 16/CCL16
Technique Recombinant
Species Human
Alternative name Human CCL16/HCC-4
Alternative technique rec
Similar products
ADAM20 siRNA Suppplier: abbex
Price: 672.94 USD
ZNF346 Suppplier: EnoGene
Price: 458.82 USD
CWC22 Polyclonal Primary Antibody Suppplier: EnoGene
Price: 424.84 USD
OR4D1 Antibody Suppplier: EnoGene
Price: 424.84 USD
STIL Antibody, Cy3 Conjugated Suppplier: Bioss Primary Conjugated Antibodies
Price: 396.52 USD
Q-VD-OPh 10mg Suppplier: ChemScene
Price: 373.86 USD
TRAFD1 antibody Suppplier: fitzgerald
Price: 321.74 USD
SYN1(Ser549) Antibody Suppplier: Bioss Primary Unconjugated Antibodies
Price: 318.34 USD
CREB Ab 129 Primary Antibody Suppplier: EnoGene
Price: 283.23 USD
anti Bovine IgG H chain Antibody Suppplier: acr
Price: 220.92 USD
1 4 3 Chloropropoxy 3 methoxyphenyl ethanone Suppplier: trca
Price: 139.35 USD
Human IGLV3 9 CRISPR Knock Out Cell Line Suppplier: ABM CrispR
Price: 6 594.61 USD
Recombinant Mouse Mitochondrial ribonuclease P protein Suppplier: MyBioSource
Price: 5.66 USD
Human Follistatin Follistatin Suppplier: MyBioSource
Price: 5.66 USD
Recombinant Human C C motif chemokine 16 CCL16 Suppplier: Biomatik
Price: 2.09 USD
Peli2 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 0.00 USD
H1fx 3 UTR GFP Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant C-C Motif Chemokine 16/CCL16 | Technique alterna
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • C-C
  • Motif
  • Chemokine
  • 16/CCL16
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee