Recombinant Human Peroxiredoxin-1/PRDX1 (N, C-6His)

• Catalog number
  CH58-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Peroxiredoxin-1 is produced by our E.coli expression system and the target gene encoding Met1-Lys199 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH
• Estimated molecular weight
  25,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of PBS, 10% glycerol, 0.1mM DTT,pH 6.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q06830
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Peroxiredoxin-1/PRDX1   C-6His  
• Gene symbol
  PRDX1
• Short name
  Recombinant Peroxiredoxin-1/PRDX1 (N, C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Peroxiredoxin-1/PRDX1(N,C-6His)
• Alternative technique
  rec
• Alternative to gene target
  peroxiredoxin 1, MSP23 and NKEF-A and NKEFA and PAG and PAGA and PAGB and PRX1 and PRXI and TDPX2, PRDX1 and IDBG-97953 and ENSG00000117450 and 5052, peroxiredoxin activity, nuclei, Prdx1 and IDBG-178542 and ENSMUSG00000028691 and 18477, PRDX1 and IDBG-640075 and ENSBTAG00000003642 and 281997

Gene info

• Identity
  HGNC:9352
• Gene
  PRDX1
• Long gene name
  peroxiredoxin 1
• Synonyms gene
  • PAGA
• Synonyms
  • NKEFA
• GenBank acession
  • BC021683
• Locus
  1p34.1
• Discovery year
  1993-11-01
• Entrez gene record
  5052
• Pubmed identfication
  • 8496166
• RefSeq identity
  • NM_181697
• Classification
  • Peroxiredoxins
• VEGA ID
  OTTHUMG00000007738

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products