Rabbit FCRLA antibody
-
Catalog number70R-7201
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenFCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE
-
SpecificityFCRLA antibody was raised against the C terminal of FCRLA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCRLA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFCRLA
-
Short nameRabbit FCRLA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FCRLA antibody raised against the C terminal of FCRLA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFc receptor-like A, FCRLA and IDBG-104321 and ENSG00000132185 and 84824, protein binding, Extracellular, Fcrla and IDBG-203915 and ENSMUSG00000038421 and 98752, FCRLA and IDBG-630028 and ENSBTAG00000034159 and 782871
-
Gene info
-
Identity
-
Gene
-
Long gene nameFc receptor like A
-
Synonyms gene
-
Synonyms gene name
- Fc receptor-like and mucin-like 1
- Fc receptor-like A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2005-05-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Immunoglobulin like domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data