Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 21 IL-21

Recombinant Human Interleukin 21 IL-21 is available 4 times from Novo labs

CC45-10 | Recombinant Human Interleukin-21/IL-21 size: 10 ug | 230.95 USD

Loading

CC45-500 | Recombinant Human Interleukin-21/IL-21 size: 500 ug | 1,997.80 USD

Loading

CC45-50 | Recombinant Human Interleukin-21/IL-21 size: 50 ug | 565.44 USD

Loading

CC45-1000 | Recombinant Human Interleukin-21/IL-21 size: 1 mg | 2,828.32 USD

Loading
Origin Escherichia coli
Description Recombinant Human Interleukin-21 is produced by our E.coli expression system and the target gene encoding Gln23-Ser155 is expressed.
Peptide sequence MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Estimated molecular weight 15,6 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Species reactivity Human
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q9HBE4
Shipping condition Ambient/Room Temperature
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-21/IL-21
Short name Recombinant Interleukin-21/IL-21
Technique Recombinant
Species Human
Alternative name recombinant H. sapiens Interleukin-21/Interleukin-21
Alternative technique rec
Similar products
Human CellExp GFER/HPO/ALR, human recombinant Suppplier: Biovision
Price: 608.67 USD
Human CellExpLAG3 CD223 human recombinant Suppplier: Biovision
Price: 398.20 USD
Human CellExp ErbB2 HER2 CD340 human recombinant Suppplier: Biovision
Price: 386.82 USD
Human CellExp CD55 DAF human recombinant Suppplier: Biovision
Price: 375.44 USD
Human CellExp CD319 SLAMF7 CRACC human recombinant Suppplier: Biovision
Price: 375.44 USD
Human CellExp CD84 SLAMF5 human recombinant Suppplier: Biovision
Price: 375.44 USD
Recombinant Human Interleukin 10 IL-10 Suppplier: novo
Price: 161.55 USD
Recombinant Human Interleukin 17B IL-17B C Suppplier: novo
Price: 161.55 USD
Recombinant Human Interleukin-20 protein(IL20) Suppplier: SAB
Price: 160.42 USD
Human CellExp LEPR CD295 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp TNFRSF4 OX40 CD134 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp CD155 human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Human Interleukin 36 beta Suppplier: MyBioSource
Price: 0.00 USD
Human CellExp Olfactomedin human recombinant Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Human Interleukin 21 IL-21 - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
  • Interleukin-21/IL-21
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee