Recombinant Rat B7-2/CD86 (C-6His)

  • Catalog number
    CP43-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Rat T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Vla29-Lys247 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Rat
  • Origin
    Human cells
  • Peptide sequence
    VPVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKHHHHHH
  • Estimated molecular weight
    25,9 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    O35531
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD86, CD276, HHLA2, RNY4P2, LRRC23, PCDHGB7, NCR3LG1, CD274, TLX1NB, CD80
  • Short name
    Recombinant B7-2/CD86 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    Recombinant Rat CD86 (C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    CD86 molecule, B7-2 and B7.2 and B70 and CD28LG2 and LAB72, CD86 and IDBG-52336 and ENSG00000114013 and 942, coreceptor activity, Cell surfaces, Cd86 and IDBG-158071 and ENSMUSG00000022901 and 12524, CD86 and IDBG-633264 and ENSBTAG00000013118 and 414345
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    RNY4 pseudogene 2
  • Synonyms gene name
    • RNA, Y4 small cytoplasmic (associated with Ro protein) pseudogene 2
    • RNA, Ro-associated Y4 pseudogene 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-08-25
  • Entrez gene record
  • RefSeq identity
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee