Recombinant Human C-type lectin domain family 4 member K/CD207 (N-6His)

• Catalog number
  CU47-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human C-type lectin domain family 4 member K is produced by our expression system and the target gene encoding Tyr64-Pro328 is expressed
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  GSGSHHHHHHIEGRYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
• Estimated molecular weight
  31.5
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q9UJ71
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  lectin   domain   family   member   K/CD207   N-6His  
• Gene symbol
  CD207
• Short name
  Recombinant C- lectin domain family 4 member K/CD207 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human CD207 (N-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD207 molecule, langerin, CD207 and IDBG-55659 and ENSG00000116031 and 50489, carbohydrate binding, Plasma membranes, Cd207 and IDBG-161509 and ENSMUSG00000034783 and 246278, CD207 and IDBG-631820 and ENSBTAG00000004562 and 511000

Gene info

• Identity
  HGNC:17935
• Gene
  CD207
• Long gene name
  CD207 molecule
• Synonyms gene name
  • CD207 antigen, langerin
  • CD207 molecule, langerin
• Synonyms
  • Langerin
  • CLEC4K
• GenBank acession
  • AJ242859
• Locus
  2p13.3
• Discovery year
  2003-10-02
• Entrez gene record
  50489
• Pubmed identfication
  • 10661407
  • 9847074
• RefSeq identity
  • NM_015717
• Classification
  • Scavenger receptors
  • C-type lectin domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000153176

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products