Influenza Virus Ns1A Binding Protein antibody
-
Catalog number
70R-2152
-
Price
Please ask
-
Size
50 µg
-
-
Category
Primary Antibody
-
Antibody Subtype
Polyclonal Antibodies, Purified
-
Area of research
Infectious Disease
-
Type of Immunogen
Influenza Virus Ns1A Binding Protein antibodies were raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
-
Raised in
Rabbit
-
Specificity
Influenza Virus Ns1A Binding Protein antibody was raised against the N terminal of IVNS1ABP
-
Cross Reactivity
Human, Dog
-
Method of Purification
Affinity purified
-
Concentration
1 mg/ml
-
Form Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IVNS1ABP antibody in PBS
-
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditions
Blue Ice
-
Tested for
WB; IHC
-
Usage Recommendations
WB: 1 ug/ml; IHC: 4-8 ug/ml
-
Assay Information
Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody
-
Additional Information
This is a rabbit polyclonal antibody against IVNS1ABP. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
-
-
Properties
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Description
Influenza A and B H1N1 H3N2 Hemagglutinin-nucleoprotein recombinant proteins, peptides and antibodies detect a virus commonly known as "the flu". Influenza is an infectious disease caused by an influenza virus. Symptoms can be mild to severe. The most common symptoms include a high fever, runny nose, sore throat, muscle pains, headache, coughing, and feeling tired. These symptoms typically begin two days after exposure to the virus and most last less than a week. The cough, however, may last for more than two weeks. In children, there may be nausea and vomiting, but these are not common in adults.
-
French translation
anticorps
-
Gene target
-
Gene symbol
IVNS1ABP
-
Short name
Influenza Virus Ns1A Binding Protein antibody
-
Technique
Antibody, antibodies against human proteins, antibodies for
-
Species
Virus, Influenza, Viruses
-
Alternative name
Rabbit polyclonal Influenza Virus Ns1A Binding Protein antibody raised against the N terminal of IVNS1ABP
-
Alternative technique
antibodies
-
Virus
influenza
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products