Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL18RAP Blocking Peptide

IL18RAP Blocking Peptide is available 2 times from Fitzgerald labs

33R-6858 | IL18RAP Blocking Peptide size: 100 ug | 321.16 USD

Loading

33R-6858 | IL18RAP Blocking Peptide size: 100 µg | 240.87 USD

Loading
Residues NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Research Area Cytokines & Growth Factors
Type of protein Synthetic
Tag/Conjugate NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Cytokines & Growth Factors
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetIL18RAP
Short name IL18RAP Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name interleukin 18 receptor accessory protein inhibiting short protein sequence
Alternative technique control
Alternative to gene target interleukin 18 receptor accessory protein, ACPL and CD218b and CDw218b and IL-18R-beta and IL-18RAcP and IL-18Rbeta and IL-1R-7 and IL-1R7 and IL-1RAcPL and IL18RB, IL18RAP and IDBG-64252 and ENSG00000115607 and 8807, protein binding, Plasma membranes, Il18rap and IDBG-148672 and ENSMUSG00000026068 and 16174, IL18RAP and IDBG-630876 and ENSBTAG00000033748 and 493716
Similar products
IL18RAP Blocking Peptide sequence Suppplier: fabgen
Price: 250.28 USD
Ask
Ajax processing
Close
IL18RAP Blocking Peptide - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee