Recombinant Human Amphiregulin/AREG

• Catalog number
  CG04-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Amphiregulin is produced by our E.coli expression system and the target gene encoding Ser101-Lys198 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
• Estimated molecular weight
  11,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P15514
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Amphiregulin/AREG  
• Gene symbol
  AREG
• Short name
  Recombinant Amphiregulin/AREG
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Amphiregulin/AREG
• Alternative technique
  rec
• Alternative to gene target
  amphiregulin, AR and AREGB and CRDGF and SDGF, AREG and IDBG-24392 and ENSG00000109321 and 374, growth factor activity, nuclei, Areg and IDBG-179096 and ENSMUSG00000029378 and 11839, BT.28934 and IDBG-643038 and ENSBTAG00000018134 and 538751

Gene info

• Identity
  HGNC:651
• Gene
  AREG
• Long gene name
  amphiregulin
• Synonyms gene
  • SDGF
  • AREGB
• Synonyms gene name
  • schwannoma-derived growth factor
  • amphiregulin B
• GenBank acession
  • M30704
• Locus
  4q13.3
• Discovery year
  1989-05-19
• Entrez gene record
  374
• Classification
  • Receptor ligands
• VEGA ID
  OTTHUMG00000130006

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products