CDK5R1 Antibody

• Catalog number
  R30162
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  CDK5R1
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.5-1ug/ml
• Notes
  The stated application concentrations are suggested starting amounts. Titration of the CDK5R1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
• Intented use
  This CDK5R1 antibodyis to be used only for research purposes and not for diagnostics..
• Gene ID
  8851
• Purity
  Antigen affinity
• Description
  CDK5R1 is also known as p35, CDK5R or NCK5A. The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimers disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimers disease.
• Immunogen
  An amino acid sequence from the N-terminus of human CDK5R1 (YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH) was used as the immunogen for this CDK5R1 antibody.
• Storage
  After reconstitution, the CDK5R1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  CDK5R1  
• Gene symbol
  CDK5R1
• Short name
  Anti-CDK5R1
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to CDK5R1
• Alternative technique
  antibodies
• Alternative to gene target
  cyclin-dependent kinase 5, regulatory subunit 1 (p35), CDK5P35 and CDK5R and NCK5A and p23 and p25 and p35 and p35nck5a, CDK5R1 and IDBG-40195 and ENSG00000176749 and 8851, ephrin receptor binding, nuclei, Cdk5r1 and IDBG-204311 and ENSMUSG00000048895 and 12569, CDK5R1 and IDBG-647094 and ENSBTAG00000004475 and 282173

Gene info

• Identity
  HGNC:1775
• Gene
  CDK5R1
• Long gene name
  cyclin dependent kinase 5 regulatory subunit 1
• Synonyms gene name
  • cyclin-dependent kinase 5, regulatory subunit 1 (p35)
• Synonyms
  • p35nck5a
  • Nck5a
  • p35
• GenBank acession
  • X80343
• Locus
  17q11.2
• Discovery year
  1999-03-08
• Entrez gene record
  8851
• Pubmed identfication
  • 8090221
• RefSeq identity
  • NM_003885
• VEGA ID
  OTTHUMG00000132814

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products