Rabbit PSMD3 antibody

• Catalog number
  70R-4327
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Protein Modification & Stress Response
• Immunogen
  PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS
• Specificity
  NA
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD3 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  PSMD3  
• Gene symbol
  PSMD3
• Short name
  Rabbit PSMD3 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal PSMD3 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  proteasome (prosome, macropain) 26S subunit, non-ATPase, 3, P58 and RPN3 and S3 and TSTA2, PSMD3 and IDBG-46805 and ENSG00000108344 and 102724103,5709, enzyme regulator activity, nuclei, Psmd3 and IDBG-210720 and ENSMUSG00000017221 and 22123, PSMD3 and IDBG-639523 and ENSBTAG00000021461 and 504937

Gene info

• Identity
  HGNC:9560
• Gene
  PSMD3
• Long gene name
  proteasome 26S subunit, non-ATPase 3
• Synonyms gene
  • TSTA2
• Synonyms gene name
  • tissue specific transplantation antigen 2
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
• Synonyms
  • S3
  • P58
  • Rpn3
• GenBank acession
  • D67025
• Locus
  17q21.1
• Discovery year
  1995-11-28
• Entrez gene record
  5709
• Pubmed identfication
  • 9017604
• RefSeq identity
  • NM_002809
• Classification
  • Proteasome
• VEGA ID
  OTTHUMG00000133251

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products