GMF-beta, human recombinant

  • Catalog number
    4880-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF
  • Alternative_names
    Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF
  • Description
    A growth and differentiation factor in the vertebrate brain
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥98%
  • Assay
    SDS-PAGE
  • Purity
    ≥98%
  • Molecular Weight
    17.0 kDa
  • Storage Temp
    -20°C
  • Shipping
    Blue ice
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl.
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
  • Background Information
    Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve growth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression. GMF-beta enhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Cell- surface GMF-Beta acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells. GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.
  • Amino acid sequence
    SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    GMFB
  • Short name
    GMF-beta, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    GMF-b, H. sapiens Rec.
  • Alternative technique
    rec
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee