Recombinant Mouse GITR/TNFRSF18/CD357 (C-Fc-6His)

• Catalog number
  CD76-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Mouse GITR is produced by our Mammalian expression system and the target gene encoding Ser22-His153 is expressed with a Fc, 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Estimated molecular weight
  42,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  O35714
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  GITR/TNFRSF18/CD357   C-Fc-6His  
• Gene symbol
  TNFRSF18
• Short name
  Recombinant Mouse GITR/TNFRSF18/CD357 (C-Fc-6His)
• Technique
  Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse GITR/TNFRSF18/CD357(C-Fc-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  tumor necrosis factor receptor superfamily, member 18, AITR and CD357 and GITR and GITR-D, TNFRSF18 and IDBG-84584 and ENSG00000186891 and 8784, protein binding, Extracellular, Tnfrsf18 and IDBG-208288 and ENSMUSG00000041954 and 21936, TNFRSF18 and IDBG-635325 and ENSBTAG00000015632 and 516256

Gene info

• Identity
  HGNC:11914
• Gene
  TNFRSF18
• Long gene name
  TNF receptor superfamily member 18
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 18
• Synonyms
  • AITR
  • GITR
  • CD357
• GenBank acession
  • AF125304
• Locus
  1p36.33
• Discovery year
  1998-12-04
• Entrez gene record
  8784
• Pubmed identfication
  • 9177197
  • 10037686
• RefSeq identity
  • NM_004195
• Classification
  • Tumor necrosis factor receptor superfamily
  • CD molecules
• VEGA ID
  OTTHUMG00000001414

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products