Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Interleukin 1ß IL-1ß

Recombinant Human Interleukin 1ß IL-1ß is available 4 times from Novo labs

CG93-500 | Recombinant Human Interleukin-1ß/IL-1ß size: 500 ug | 1,918.72 USD

Loading

CG93-1000 | Recombinant Human Interleukin-1ß/IL-1ß size: 1 mg | 2,714.03 USD

Loading

CG93-50 | Recombinant Human Interleukin-1ß/IL-1ß size: 50 ug | 439.86 USD

Catalog number CG93-50
Supplier novo
Price 439.86 USD
Size 50 ug
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 5990
Gene IL19
Long gene name interleukin 19
Synonyms
  • IL-19
  • MDA1
  • ZMDA1
  • IL-10C
  • NG.1
Synonyms name
  • melanoma differentiation associated protein-like protein
GenBank acession
  • AF192498
Locus 1q32.1
Discovery year 2000-03-29
Entrez gene record 29949
Pubmed identfication
  • 11196675
RefSeq identity
  • NM_153758
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000036387
2. Gene info
Identity 5991
Gene IL1A
Long gene name interleukin 1 alpha
Synonyms gene
  • IL1
Synonyms
  • IL1F1
  • IL-1A
  • IL1-ALPHA
Synonyms name
  • preinterleukin 1 alpha
  • hematopoietin-1
  • pro-interleukin-1-alpha
GenBank acession
  • M28983
Locus 2q14.1
Discovery year 2001-06-22
Entrez gene record 3552
Pubmed identfication
  • 8188271
  • 2989698
RefSeq identity
  • NM_000575
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131315
3. Gene info
Identity 15741
Gene IL36G
Long gene name interleukin 36 gamma
Synonyms gene
  • IL1F9
Synonyms gene name
  • interleukin 1 family, member 9
Synonyms
  • IL-1H1
  • IL-1RP2
  • IL-1F9
  • IL1H1
  • IL1E
Synonyms name
  • interleukin-1 homolog 1
  • interleukin 1-related protein 2
  • interleukin-1 epsilon
GenBank acession
  • AF200492
Locus 2q14.1
Discovery year 2002-08-02
Entrez gene record 56300
Pubmed identfication
  • 10860666
  • 10744718
  • 11991722
  • 11991723
RefSeq identity
  • NM_019618
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131336
Product images
    #Human#.jpg

CG93-10 | Recombinant Human Interleukin-1ß/IL-1ß size: 10 ug | 186.64 USD

Loading
Description Recombinant Human Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Ala117-Ser269 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Estimated molecular weight 17,5 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P01584
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-1ß/IL-1ß
Short name Recombinant Interleukin-1ß/IL-1ß
Technique Recombinant
Species Humans
Alternative name Human IL-1 beta/IL-1F2/IL-1b
Alternative technique rec
Similar products
recombinant HUMAN INTERLEUKIN Suppplier: genways
Price: 495.73 USD
Recombinant Human Interleukin 24 Suppplier: genDEPOT
Price: 275.80 USD
Recombinant Human Interleukin 2 Suppplier: genDEPOT
Price: 275.80 USD
Recombinant Human Interleukin 22 Suppplier: genDEPOT
Price: 275.80 USD
Recombinant Human Interleukin 33 Suppplier: genDEPOT
Price: 275.80 USD
Recombinant Human Interleukin 9 Suppplier: genDEPOT
Price: 275.80 USD
Recombinant Human Interleukin 11 IL-11 Suppplier: novo
Price: 241.33 USD
Recombinant Human Interleukin 21 IL-21 Suppplier: novo
Price: 241.33 USD
Recombinant Human Interleukin 37 IL-37 Suppplier: novo
Price: 241.33 USD
Recombinant Human Interleukin 20 IL-20 Suppplier: novo
Price: 241.33 USD
Recombinant Human Interleukin 16 IL-16 Suppplier: novo
Price: 241.33 USD
Recombinant Human Interleukin 19 Suppplier: CHI Scientific
Price: 205.66 USD
Recombinant Human Interleukin 5 Suppplier: CHI Scientific
Price: 205.66 USD
Recombinant Human Interleukin 9 Suppplier: CHI Scientific
Price: 205.66 USD
Recombinant Human Interleukin 6 IL-6 Suppplier: novo
Price: 200.91 USD
RECOMBINANT HUMAN INTERLEUKIN 12 Suppplier: MyBioSource
Price: 5.94 USD
Recombinant Human Interleukin 35 Suppplier: MyBioSource
Price: 5.94 USD
Recombinant Human Interleukin 12[Interleukin 12] Suppplier: MyBioSource
Price: 5.94 USD
Ask
Ajax processing
Close
Recombinant Interleukin-1ß/IL-1ß | Technique alternative | 0
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-1ß/IL-1ß
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee