-
Target antigen
ADRA1A
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ADRA1A Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ADRA1A Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
-
Related articles
1. Hirasawa, A., Horie, K., Tanaka, T., Takagaki, K., Murai, M., Yano, J., Tsujimoto, G.Cloning, functional expression and tissue distribution of human cDNA for the alpha-1C-adrenergic receptor. Biochem. Biophys. Res. Commun. 195: 902-909, 1993. 2. Langer SZ (1998). "Nomenclature and state of the art on alpha1-adrenoceptors". Eur. Urol. 33 Suppl 2: 2–6. 3. Weinberg, D. H., Trivedi, P., Tan, C. P., Mitra, S., Perkins-Barrow, A., Borkowski, D., Strader, C. D., Bayne, M. Cloning, expression and characterization of human alpha adrenergic receptors alpha-1A, alpha-1B, and alpha-1C. Biochem. Biophys. Res. Commun. 201: 1296-1304, 1994.
-
Gene Name
ADRA1A
-
Protein Name
Alpha-1A adrenergic receptor
-
Gene Full Name
adrenoceptor alpha 1A
-
Synonyms
ADA1D_HUMAN antibody|Adra1 antibody|Adra1a antibody|Adra1d antibody|ADRA1R antibody|Adrd1 antibody|Adrenergic alpha1A receptor antibody|Adrenergic alpha1D receptor antibody|Adrenergic receptor alpha 1d antibody|Adrenergic receptor delta1 antibody|Adrenoceptor alpha 1D antibody|Alpha 1D adrenoceptor antibody|Alpha 1D adrenoreceptor antibody|Alpha adrenergic receptor 1a antibody|Alpha-1A adrenergic receptor antibody|Alpha-1D adrenergic receptor antibody|Alpha-1D adrenoceptor antibody|Alpha-1D adrenoreceptor antibody| Alpha-adrenergic receptor 1a antibody|ALPHA1 antibody|Alpha1A adrenergic receptor antibody|Alpha1D adrenergic receptor antibody| Alpha1DAR antibody|DAR antibody|dJ779E11.2 antibody|Gpcr8 antibody|RA42 antibody|Spr8 antibody
-
Uniprot ID
P35348
-
Entrez GeneID
148
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
