Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Calsyntenin 3 antibody

Calsyntenin 3 antibody is available 1 time from Fitzgerald labs

70R-6618 | Calsyntenin 3 antibody size: 50 µg | 546.49 USD

Loading
Category Primary Antibody
Tested for WB
Raised in Rabbit
Product Subtype Purified Polyclonal Antibodies
Antibody Subtype Polyclonal Antibodies, Purified
Method of Purification Affinity purified
Specificity Calsyntenin 3 antibody was raised against the N terminal of CLSTN3
Additional Information This is a rabbit polyclonal antibody against CLSTN3, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Immunogen Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
Shipping Info Blue Ice
Shipping conditions Blue Ice
Assay Information Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody
Applications WB
Research Area Neuroscience
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLSTN3 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Usage Recommendations WB: 1 ug/ml
Product Type Primary Antibodies
Type of Immunogen Calsyntenin 3 antibodies were raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
Area of research Neuroscience
Cross Reactivity Human
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetCalsyntenin
Short name Calsyntenin 3 antibody
Technique Antibody
Alternative name Calsyntenin 3 (Antibody to)
Alternative technique antibodies
Similar products
Rabbit Calsyntenin antibody Suppplier: fitzgerald
Price: 569.50 USD
Calsyntenin 1 antibody Suppplier: fitzgerald
Price: 546.49 USD
Rabbit, Anti-Calsyntenin 2 (CLSTN2)-Polyclonal antibody Suppplier: Cloud Clone Corp
Price: 1 783.28 USD
Calsyntenin 1 antibody Suppplier: MyBioSource
Price: 636.23 USD
Calsyntenin 3 antibody Suppplier: MyBioSource
Price: 636.23 USD
Ask
Ajax processing
Close
Calsyntenin 3 antibody - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee