Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Rat Fibroblast growth factor 23 Fgf23

Recombinant Rat Fibroblast growth factor 23 Fgf23 is available 5 times from Bioma labs

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23) size: 50 μg | 353.85 USD

Loading

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23) size: 200 μg | 786.83 USD

Loading

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23) size: 100 μg | 523.42 USD

Loading

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23) size: 1 mg | 1,807.67 USD

Loading

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23) size: 10 μg | 186.53 USD

Loading
Other name no alternative name
Protein origin E.coli
Estimated production time 7-11 business days
Gene number Fgf23
Gene name Fgf23
Protein number Q8VI82
Protein sequence YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
Notes For research use only. Not for diagnostic procedures.
Use before 1 year
Information about sequence Full Length
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Shipping requirements Blue ice
Verified reactivity Rattus norvegicus (Rat)
Protein purity ≥ 90%
Protein region 25-251aa
Description Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
About Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
Latin name Rattus norvegicus
Source Recombinants or rec. proteins
Group recombinants
Short name Recombinant Fibroblast growth factor 23(Fgf23)
Technique Recombinant
Host Rat
Species Rat
Alternative name recombinant Rat Fibroblast growth factor 23(Fgf23)
Alternative technique rec
Similar products
Recombinant Rat Fibroblast growth factor 23 Fgf23 Suppplier: Biomatik
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor 18 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Mouse Fibroblast growth factor 23 (Fgf23) Suppplier: MyBioSource
Price: 837.70 USD
Recombinant Rat Fibroblast growth factor 14 (Fgf14) Suppplier: MyBioSource
Price: 868.22 USD
Recombinant Rat Fibroblast growth factor 9 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor 10 Fgf10 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor 16 Fgf16 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor 23 Suppplier: MyBioSource
Price: 194.45 USD
Recombinant Rat Fibroblast growth factor 2 Fgf2 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor receptor Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Rat Fibroblast growth factor 20 (Fgf20) Suppplier: MyBioSource
Price: 818.48 USD
Recombinant Rat Fibroblast growth factor 17 Fgf17 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant rat Fibroblast growth factor 23 Suppplier: SAB
Price: 312.02 USD
Recombinant Rat Fibroblast growth factor 7 Fgf7 Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Rat Fibroblast growth factor 23 Fgf23 - bioma
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee