Human CellExp™ CHI3L3, Mouse Recombinant

  • Catalog number
    P1312-10
  • Price
    Please ask
  • Size
    10 µg
  • Synonyms
    Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
  • Alternative_names
    Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
  • Description
    Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.
  • Recombinant
    Yes
  • Source
    HEK 293 cells
  • Purity by SDS PAGE
    ≥95%
  • Assay
    SDS-PAGE
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized
  • Physical form description
    Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
  • Reconstitution Instructions
    Reconstitute in sterile deionized water to a concentration of 100 µg/ml.
  • Background Information
    Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.
  • Amino acid sequence
    YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSASCKGPYVDHHHHHH
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used on humans
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    CellExp™ CHI3L3, Mouse Recombinant
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Humans, Mouses
  • Alternative name
    H. sapiens CellExp™ CHI3L3, Mouse Rec.
  • Alternative technique
    rec, murine
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee