Recombinant Human Protein Disulfide-Isomerase A5/PDIA5 (C-6His)

• Catalog number
  CD96-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Protein disulfide-isomerase A5 is produced by our Mammalian expression system and the target gene encoding Ser22-Leu262 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKKVWPLVDHHHHHH
• Estimated molecular weight
  28,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9BV43
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Protein   Disulfide-Isomerase   A5/PDIA5   C-6His  
• Gene symbol
  PDIA5
• Short name
  Recombinant Protein Disulfide-Isomerase A5/PDIA5 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Protein disulfide-isomerase A5/PDIA5(C-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:24811
• Gene
  PDIA5
• Long gene name
  protein disulfide isomerase family A member 5
• Synonyms gene name
  • protein disulfide isomerase-associated 5
  • protein disulfide isomerase family A, member 5
• Synonyms
  • PDIR
  • FLJ30401
• GenBank acession
  • AK054963
• Locus
  3q21.1
• Discovery year
  2005-03-02
• Entrez gene record
  10954
• Pubmed identfication
  • 7556671
• RefSeq identity
  • NM_006810
• Classification
  • Protein disulfide isomerases
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000159558

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products