Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)

  • Catalog number
    RPC20584
  • Price
    Please ask
  • Size
    20 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P17693
  • Gene number
    HLA-G
  • Other name
    HLA G antigen; MHC class I antigen G
  • Protein origin
    Mammalian cell
  • Protein region
    25-338aa
  • Protein sequence
    GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
  • Information about sequence
    Full Length
  • Expected molecular weight
    18.18kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    The Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLA-G) is a α- or alpha protein sometimes glycoprotein present in blood. Antigens are peptides or recombinant or native dependent on the production method.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    HLA-G, HLA-DPA2, HLA-DOA, HLA-DQA1, HLA-N, HLA-DPB1, HLA-DQA2, HLA-DQB2, HLA-W, HLA-DRA
  • Short name
    Recombinant HLA class I histocompatibility antigen, alpha chain G protein(HLA-G)
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Human leukocyte antigen class I histocompatibility protein, a epitope G protein(major histocompatibility complex, class I, G)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    major histocompatibility complex, class I, G, MHC-G, HLA-G and IDBG-298543 and ENSG00000204632 and 3135, protein homodimerization activity, Plasma membranes
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Testing erythrocytes to determine presence or absence of blood-group antigens, testing of serum to determine the presence or absence of antibodies to these antigens, and selecting biocompatible blood by crossmatching samples from the donor against samples from the recipient. Crossmatching is performed prior to transfusion.
  • Tree numbers
    • E01.370.225.625.120
    • E01.370.225.812.385.120
    • E05.200.625.120
    • E05.200.812.385.120
    • E05.478.594.385.120
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee