Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human TNF

Recombinant Human TNF is available 8 times from Novo labs

CK44-50 | Recombinant Human TNF Receptor Superfamily Member 11B/OPG (C-Fc) size: 50 ug | 560.42 USD

Loading

CK44-10 | Recombinant Human TNF Receptor Superfamily Member 11B/OPG (C-Fc) size: 10 ug | 228.90 USD

Loading

CK44-500 | Recombinant Human TNF Receptor Superfamily Member 11B/OPG (C-Fc) size: 500 ug | 1,819.95 USD

Loading

CK44-1000 | Recombinant Human TNF Receptor Superfamily Member 11B/OPG (C-Fc) size: 1 mg | 2,803.21 USD

Loading

C038-1000 | Recombinant Human TNF-Like 1/TL1A/TNFSF15 size: 1 mg | 3,078.35 USD

Catalog number C038-1000
Supplier novo
Price 3,078.35 USD
Size 1 mg
Description Recombinant Human TNF-like 1 is produced by our E.coli expression system and the target gene encoding Met1-Leu192 is expressed.
Origin Escherichia coli
Peptide sequence MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Estimated molecular weight 21,86 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, pH 7.5.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
UniProt number O95150-2
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene Tumor necrosis factor (TNFa, tumor necrosis factor alpha, TNFα, cachexin, or cachectin) is a cell signaling protein (cytokine) involved in systemic inflammation and is one of the cytokines that make up the acute phase reaction. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. TNFb or TNF beta also bin on TNF receptors for Th1 activation.
Gene targetTNF-Like 1/TL1A/TNFSF15
Short name Recombinant TNF-Like 1/TL1A/TNFSF15
Technique Recombinant
Alternative name Human TNF-like 1/TL1/TNFSF15
Alternative to gene target tumor necrosis factor (ligand) superfamily, member 15, TL1 and TL1A and VEGI and VEGI192A, TNFSF15 and IDBG-82298 and ENSG00000181634 and 9966, protein binding, Extracellular, Tnfsf15 and IDBG-155748 and ENSMUSG00000050395 and 326623, TNFSF15 and IDBG-638648 and ENSBTAG00000018069 and 514239, tumor necrosis factor, DIF and TNF-alpha and TNFA and TNFSF2, TNF and IDBG-300259 and ENSG00000232810 and 7124, transcription regulatory region DNA binding, Extracellular, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943
1. Gene info
Identity 11931
Gene TNFSF15
Long gene name TNF superfamily member 15
Synonyms gene name
  • tumor necrosis factor (ligand) superfamily, member 15
Synonyms
  • TL1
  • VEGI
  • TL1A
  • VEGI192A
  • MGC129934
  • MGC129935
Synonyms name
  • vascular endothelial cell growth inhibitor
  • TNF superfamily ligand TL1A
  • TNF ligand-related molecule 1
  • vascular endothelial growth inhibitor-192A
GenBank acession
  • AF039390
Locus 9q32
Discovery year 1998-12-04
Entrez gene record 9966
Pubmed identfication
  • 9434163
RefSeq identity
  • NM_005118
Classification
  • Tumor necrosis factor superfamily
Havana BLAST/BLAT OTTHUMG00000021011
2. Gene info
Identity 11892
Gene TNF
Long gene name tumor necrosis factor
Synonyms gene
  • TNFA
Synonyms gene name
  • tumor necrosis factor (TNF superfamily, member 2)
Synonyms
  • TNFSF2
  • DIF
  • TNF-alpha
Synonyms name
  • TNF superfamily, member 2
GenBank acession
  • X02910
Locus 6p21.33
Discovery year 1986-01-01
Entrez gene record 7124
Pubmed identfication
  • 2413547
  • 6392892
Classification
  • Tumor necrosis factor superfamily
Havana BLAST/BLAT OTTHUMG00000031194
Product images
    #Human#.jpg

C038-50 | Recombinant Human TNF-Like 1/TL1A/TNFSF15 size: 50 ug | 457.81 USD

Loading

C038-500 | Recombinant Human TNF-Like 1/TL1A/TNFSF15 size: 500 ug | 2,174.01 USD

Loading

C038-10 | Recombinant Human TNF-Like 1/TL1A/TNFSF15 size: 10 ug | 190.56 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Species Human
Alternative technique rec
Similar products
PSME4 shRNA Plasmid Suppplier: MyBioSource
Price: 729.56 USD
Recombinant Nostoc sp. 10 kDa chaperonin (groS) Suppplier: MyBioSource
Price: 673.18 USD
MAZ siRNA Suppplier: abbex
Price: 669.79 USD
THAP7 siRNA Suppplier: abbex
Price: 669.79 USD
Chicken gonadotropin-inhibitory hormone (GnIH) ELISA Kit Suppplier: MyBioSource
Price: 641.60 USD
Protein SET SET ELISA Kit Suppplier: Glorybioscience
Price: 559.29 USD
Actin pan α β γ Ab 53 55 Antibody Suppplier: EnoGene
Price: 422.85 USD
ICAM 2 Polyclonal Antibody Suppplier: SAB
Price: 382.26 USD
Serine carboxypeptidase 1 Antibody Conjugated Suppplier: Bioss Primary Conjugated Antibodies
Price: 375.49 USD
sCD34 Recombinant Protein Suppplier: Zyagen
Price: 288.67 USD
4-Borono-D-phenylalanine Suppplier: Molekula
Price: 277.39 USD
C1ORF43 Blocking Peptide Suppplier: fitzgerald
Price: 236.80 USD
M-Standard Methods Broth Suppplier: Himedia
Price: 183.80 USD
Potassium Chloride Suppplier: trca
Price: 138.69 USD
3-Bromo-4-methoxyphenyl mesylate Suppplier: trca
Price: 121.78 USD
Ask
Ajax processing
Close
Recombinant TNF-Like 1/TL1A/TNFSF15 | Technique alternative
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • TNF
  • Receptor
  • Superfamily
  • Member
  • 11B/OPG
  • C-Fc
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee