-
Availability
Please contact us to check the availability
-
Immunogen
Recombinant human CDX2 AS 1-314 with GST-Tag. MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQ
-
Specificity
CDX2, human
-
Species reactivity
Human, others not tested
-
Product presentation
Purified IgG in PBS, pH 7.2, 0,09% sodium azide
-
Product category
Primary Antibody
-
Antibody s raised in
Mouse
-
Antibody s isotype
IgG mix kappa
-
Antibody s clone
1C7
-
Product is supplied as
liquid concentrate
-
Recommended concentration for use
3 µg/ml
-
Protein concentration
50 µg/ml
-
Positive control
Colon carcinoma
-
Pretreatment
Formalin-fixed tissue requires antigen unmasking in citrate buffer pH 6 (Art. No. DE000) 15-30 min at 100°C. Blocking of endogenous oxido-reductases with H2O2 1% 30 min., blocking of non-specific protein binding with SeaBlock (Art. No. PU083). Endogenous Biotin may be blocked with help of the VECTOR Avidin/Biotin Blocking Kit Ref. SP-2001) to avoid non-specific background staining.
-
Tested applications
IHC(C, P)
-
Recommended secondary reagent
We recommend the use of Gentaur's Universal Staining System DAB (Art. No. DA005) or AEC (Art.-No. AE005), if higher sensitivity is required VECTASTAIN Elite ABC (Art. No. PK-6102) or ABC AP (Art. No. AK-5002) systems are applicable.
-
Storage method
Store at 2-8°C
-
UniProt number
Go to UniProt/SwissProt
-
Litterature
1. Barbareschi M., Murer B., Colby T.V., Chilosi M., Macri E., Loda M., Coglioni C. (2003) CDX-2 homeobox gene expression is a reliable marker of colorectal adenocarcinoma metastases to the lungs. Am J. Surg. Pathol. 27; 141-149 2. Werling R.W. Yaziji H., Bacchi C.E., Gown A.M. (2003) CDX2, a highly sensitive and specific marker of adenocarcinomas of intestinal origin: An immunohistochemical survey of 476 primary and metastatic carcinomas. Am. J. Surg. Pathol. 27; 303-310.
-
Tips
*Gentaur's antibodies are intended for in vitro research use only. They must not be used for clinical diagnostics and not for in vivo experiments in humans or animals. ** The preservative sodium azide is known to be poisonous and potentially hazardous to health. It should be handled only by trained staff. Despite of the product's low azide concentration it must be handled with care. Dispose according to regional rules!
-
-
Description
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
-
About
Immunoglobulin gamma, IgG, mouse monoclonal H&L chain clones or rabbit, goat polyclonal antibodies have 4 parts. There are 2 heavy chains, 2 light chains. The IgG antibody has 2 antigen binding sites. They represent 70% or more of serum antibodies. This antibody can be antigen purified or protein A or G purified. For storage sodium azide is added or you can call us to request azide free antibody preparations. These will need colder storage temperatures. Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
