Rabbit SOCS1 antibody
-
Catalog number70R-5877
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenSOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
-
SpecificitySOCS1 antibody was raised against the middle region of SOCS1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSOCS1
-
Short nameRabbit SOCS1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SOCS1 antibody raised against the middle region of SOCS1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetsuppressor of cytokine signaling 1, CIS1 and CISH1 and JAB and SOCS-1 and SSI-1 and SSI1 and TIP3, SOCS1 and IDBG-14621 and ENSG00000185338 and 8651, protein kinase binding, nuclei, Socs1 and IDBG-132667 and ENSMUSG00000038037 and 12703, SOCS1 and IDBG-648701 and ENSBTAG00000004386 and 518795
-
Gene info
-
Identity
-
Gene
-
Long gene namesuppressor of cytokine signaling 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-11-13
-
Pubmed identfication
-
Classification
- Suppressors of cytokine signaling
- SH2 domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data