Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

BLNK antibody

BLNK antibody is available 5 times from Fitzgerald labs

70R-35546 | BLNK antibody size: 100 µg | 430.27 USD


10R-10959 | BLNK antibody size: 100 µg | 457.93 USD


70R-5736 | BLNK antibody size: 50 µg | 525.40 USD

Catalog number 70R-5736
Supplier fitzgerald
Price 525.40 USD
Size 50 µg
Antibody Subtype Polyclonal Antibodies, Purified
Area of research Immunology
Type of Immunogen BLNK antibodies were raised using the middle region of BLNK corresponding to a region with amino acids QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV
Raised in Rabbit
Specificity BLNK antibody was raised against the middle region of BLNK
Cross Reactivity Human, Mouse, Rat
Method of Purification Affinity purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BLNK antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1 ug/ml
Assay Information BLNK Blocking Peptide, catalog no. 33R-7788, is also available for use as a blocking control in assays to test for specificity of this BLNK antibody
Additional Information This is a rabbit polyclonal antibody against BLNK, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
MeSH Data
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200

70R-16005 | BLNK antibody size: 50 µl | 566.32 USD


70R-50961 | BLNK antibody size: 100 µl | 593.98 USD

Category Primary Antibody
Product Type Primary Antibodies
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetBLNK
Short name BLNK antibody
Technique Antibody
Alternative name B-cell linker (Antibody to)
Alternative technique antibodies
Alternative to gene target B-cell linker, BLNK and IDBG-83724 and ENSG00000095585 and 29760, protein binding, Plasma membranes, Blnk and IDBG-165316 and ENSMUSG00000061132 and 17060, BT.24520 and IDBG-638042 and ENSBTAG00000021358 and 510393
Similar products
Mouse BLNK antibody Suppplier: genways
Price: 647.07 USD
BLNK antibody (phospho Tyr84) Suppplier: genways
Price: 588.45 USD
BLNK antibody Suppplier: genways
Price: 576.28 USD
Mouse monoclonal BLNK antibody Suppplier: MyBioSource
Price: 537.56 USD
Mouse BLNK antibody Suppplier: fitzgerald
Price: 492.21 USD
Rabbit BLNK antibody Suppplier: fitzgerald
Price: 470.09 USD
BLNK antibody Suppplier: aviva
Price: 468.99 USD
BLNK antibody Tyr84 Suppplier: fitzgerald
Price: 430.27 USD
BLNK antibody Tyr96 Suppplier: fitzgerald
Price: 430.27 USD
BLNK antibody - middle region Suppplier: aviva
Price: 346.21 USD
Ajax processing
BLNK antibody size: 50 µg -
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • BLNK
Contact us
Ajax processing
Chat with employee