Recombinant Human PD-L1/B7-H1/CD274 (C-6His)

  • Catalog number
    C315-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human Programmed Cell Death 1 Ligand 1 is produced by our Mammalian expression system and the target gene encoding Phe19-Thr239 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTVDHHHHHH
  • Estimated molecular weight
    26,33 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q9NZQ7
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD274, PDCD1LG2, VSIR, H1-9P, HHLA2, RLN1, H1-8, RNY4P2, LRRC23, ENPP2
  • Short name
    Recombinant PD-L1/B7-H1/CD274 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human PD-L1/B7-H1/CD274(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    CD274 molecule, CD274 and IDBG-47487 and ENSG00000120217 and 29126, protein binding, Cell surfaces, Cd274 and IDBG-157249 and ENSMUSG00000016496 and 60533, PD-L1 and IDBG-631351 and ENSBTAG00000000095 and 533834
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    H1.9 linker histone, pseudogene
  • Synonyms gene
  • Synonyms gene name
    • histone linker H1 domain, spermatid-specific 1
    • histone linker H1 domain, spermatid-specific 1 (pseudogene)
    • H1.9 linker histone (pseudogene)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2005-12-16
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • H1 histones
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    H1.8 linker histone
  • Synonyms gene
  • Synonyms gene name
    • H1 histone family, member O, oocyte-specific
    • H1 histone family member O oocyte specific
  • GenBank acession
  • Locus
  • Discovery year
    2003-05-23
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • H1 histones
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    RNY4 pseudogene 2
  • Synonyms gene name
    • RNA, Y4 small cytoplasmic (associated with Ro protein) pseudogene 2
    • RNA, Ro-associated Y4 pseudogene 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-08-25
  • Entrez gene record
  • RefSeq identity
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee