Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Anti-CXCR4 Picoband Antibody

Anti-CXCR4 Picoband Antibody is available 1 time from Boster labs

A00031 | Anti-CXCR4 Picoband Antibody size: 100µg/vial | 442.49 USD

Catalog number A00031
Supplier boster
Price 442.49 USD
Size 100µg/vial
1. Gene info
Identity 2561
Gene CXCR4
Long gene name C-X-C motif chemokine receptor 4
Synonyms gene name
  • chemokine (C-X-C motif), receptor 4 (fusin)
  • chemokine (C-X-C motif) receptor 4
Synonyms
  • LESTR
  • NPY3R
  • HM89
  • NPYY3R
  • D2S201E
  • fusin
  • HSY3RR
  • NPYR
  • CD184
GenBank acession
  • AF005058
Locus 2q22.1
Discovery year 1998-09-17
Entrez gene record 7852
Pubmed identfication
  • 9599023
  • 9379028
Classification
  • CD molecules
  • C-X-C motif chemokine receptors
Havana BLAST/BLAT OTTHUMG00000153583
Locus Specific Databases
  • CXCR4base: Mutation registry for WHIM syndrome (warts, hypogammaglobulinemia, immunodeficiency, and myelokathexis)
  • LRG_51
MeSH Data
Name Blotting, Western
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
Clonality Polyclonal
Storage & Transport Conditions At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Form Lyophilized
Product Datasheet www.bosterbio.com/datasheet.php?sku=A00031
Sample Size Available 30ug for $99, contact us for details
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Purification Immunogen affinity purified.
Applications WB
Cross-reactivity No cross reactivity with other proteins.
Ig Type N/A
Application Details Western blot, 0.1-0.5µg/ml, Human
Reactivity Human
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetCXCR4 Picoband
Short name Anti-CXCR4 Picoband Antibody
Technique Antibody, anti
Alternative name antibody to-chemokine (C-X-C motif) receptor 4 Picoband (Antibody to)
Alternative technique antibodies
Alternative to gene target chemokine (C-X-C motif) receptor 4, CD184 and D2S201E and FB22 and HM89 and HSY3RR and LAP-3 and LAP3 and LCR1 and LESTR and NPY3R and NPYR and NPYRL and NPYY3R and WHIM, CXCR4 and IDBG-71032 and ENSG00000121966 and 7852, ubiquitin binding, Cell surfaces, Cxcr4 and IDBG-189999 and ENSMUSG00000045382 and 12767, CXCR4 and IDBG-642187 and ENSBTAG00000001060 and 281736
Similar products
Anti-IGF2R Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-HTRA1/Htra Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-XRCC1 Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-PERK Picoband antibody Suppplier: boster
Price: 442.49 USD
Anti-MVP Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-GLO1/Glyoxalase I Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-SOX10 Picoband antibody Suppplier: boster
Price: 442.49 USD
Anti-STAT2 Picoband antibody Suppplier: boster
Price: 442.49 USD
Mouse, Anti-Vinculin (VCL) Monoclonal Antibody-Monoclonal antibody Suppplier: Cloud Clone Corp
Price: 1 168.64 USD
Anti-PRDM1/Blimp1 Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-Psoriasin Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-p38 Antibody Polyclonal antibody Suppplier: QED Biosciences
Price: 390.70 USD
Anti-Integrin alpha 5 Picoband antibody Suppplier: boster
Price: 487.88 USD
Anti-Alpha 1 Fetoprotein Picoband antibody Suppplier: boster
Price: 442.49 USD
Ask
Ajax processing
Close
Anti-CXCR4 Picoband Antibody - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee