Recombinant Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)

  • Catalog number
    RPC20398
  • Price
    Please ask
  • Size
    50 μg
  • Verified reactivity
    Arabidopsis thaliana (Mouse-ear cress)
  • Protein number
    Q96291
  • Gene number
    BAS1
  • Other name
    Thiol-specific antioxidant protein A
  • Protein origin
    Yeast
  • Protein region
    66-266aa
  • Protein sequence
    KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI
  • Information about sequence
    Full Length
  • Expected molecular weight
    24.44kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-tagged
  • Species
    Mouses
  • Alternative name
    Rec. Mouse-ear cress 2-Cys peroxiredoxin BAS1, chloroplastic (BAS1)
  • Alternative technique
    rec, murine
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee