LSM14A Blocking Peptide

• Catalog number
  33R-4505
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  DNA & RNA
• Tag Conjugate
  KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  LSM14A  
• Gene symbol
  LSM14A
• Short name
  LSM14A Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  LSM14A, SCD6 homolog A (S. cerevisiae) inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  LSM14A, SCD6 homolog A (S. cerevisiae), C19orf13 and FAM61A and RAP55 and RAP55A, LSM14A and IDBG-547325 and ENSG00000257103 and 26065, poly(A) RNA binding, Cytoplasm, Lsm14a and IDBG-173430 and ENSMUSG00000066568 and 67070, BT.40231 and IDBG-635346 and ENSBTAG00000000630 and 538838

Gene info

• Identity
  HGNC:24489
• Gene
  LSM14A
• Long gene name
  LSM14A mRNA processing body assembly factor
• Synonyms gene
  • C19orf13
  • FAM61A
• Synonyms gene name
  • chromosome 19 open reading frame 13
  • family with sequence similarity 61, member A
  • LSM14 homolog A (SCD6, S. cerevisiae)
  • LSM14A, mRNA processing body assembly factor
• Synonyms
  • DKFZP434D1335
  • RAP55A
  • RAP55
• Synonyms name
  • RNA-associated protein 55
• GenBank acession
  • AL834398
• Locus
  19q13.11
• Discovery year
  2004-02-11
• Entrez gene record
  26065
• Pubmed identfication
  • 15225602
  • 22745163
• RefSeq identity
  • NM_015578
• Classification
  • LSm proteins
• VEGA ID
  OTTHUMG00000180491

Similar products