Recombinant Mouse Prostate stem cell antigen(Psca)

  • Catalog number
    RPC20241
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P57096
  • Gene name
    Psca
  • Other name
    no alternative name
  • Protein origin
    Yeast
  • Protein region
    21-95aa
  • Protein sequence
    LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
  • Information about sequence
    Full Length
  • Expected molecular weight
    10,4kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method. For cells, cell lines and tissues in culture till half confluency.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain. Stem cell factors and stem cell growth factors will produce stem cells or be part of a transdifferentiation process to produce other cells. A cell can transdifferentiate by going back to the naive stem cell stadium or directly into the other cell, helped by the stem cell and transdifferentiationf actors. Stem cell growth factors or stem cell factors are mostly used to produce iPSCs or induced pluripotent stem cells by Jamaka or Thomson factors by using for example 5 Lenti-III-CMV viruses, expressing the Yamanaka iPSC factor set (Oct4, Sox2, Nanog and Lin28) + GFP positive control. Trans differentiation will omit the stem cell stadium but stem cell factors sill play an important role in trans differentiation strategies.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Prostate   stem   Psca  
  • Gene symbol
    PSCA
  • Short name
    Recombinant Mouse Prostate stem antigen(Psca)
  • Technique
    Recombinant, antigen, Mouse, antigenes, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Prostate progenitor cellular protein(Psca)
  • Alternative technique
    rec, antigenes, murine
  • Tissue
    cell, prostate, stem
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee