UBE2N Blocking Peptide

• Catalog number
  33R-3532
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Protein Modification & Stress Response
• Tag Conjugate
  GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  UBE2N  
• Gene symbol
  UBE2N
• Short name
  UBE2N Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  ubiquitin-conjugating enzyme E2N inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  ubiquitin-conjugating enzyme E2N, HEL-S-71 and UBC13 and UbcH-ben and UbcH13 and UBCHBEN; UBC13, UBE2N and IDBG-51220 and ENSG00000177889 and 389898,7334, poly(A) RNA binding, nuclei, Ube2n and IDBG-187167 and ENSMUSG00000074781 and 102642334,93765, UBE2N and IDBG-630838 and ENSBTAG00000021767 and 541130

Gene info

• Identity
  HGNC:12492
• Gene
  UBE2N
• Long gene name
  ubiquitin conjugating enzyme E2 N
• Synonyms gene name
  • ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13)
  • ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
  • ubiquitin-conjugating enzyme E2N
• Synonyms
  • UbcH-ben
  • UBC13
  • MGC8489
• GenBank acession
  • D83004
• Locus
  12q22
• Discovery year
  1997-04-16
• Entrez gene record
  7334
• Pubmed identfication
  • 8902611
• RefSeq identity
  • NM_003348
• Classification
  • Ubiquitin conjugating enzymes E2
• VEGA ID
  OTTHUMG00000170156

Similar products