Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His)

• Catalog number
  C287-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human PINX1 is produced by our E.coli expression system and the target gene encoding Met1-Lys328 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
• Estimated molecular weight
  39,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q96BK5
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  TERF1-Interacting   Telomerase   Inhibitor   1/PIN2/PINX1   N-6His  
• Gene symbol
  TERF1, PINX1-DT, PINX1
• Short name
  Recombinant TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human PIN2/PINX1(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  telomeric repeat binding factor (NIMA-interacting) 1, hTRF1-AS and PIN2 and t-TRF1 and TRBF1 and TRF and TRF1, TERF1 and IDBG-25349 and ENSG00000147601 and 7013, DNA binding, nuclei, Terf1 and IDBG-134893 and ENSMUSG00000025925 and 21749, BT.23286 and IDBG-644763 and ENSBTAG00000032982 and 519474

Gene info

• Identity
  HGNC:11728
• Gene
  TERF1
• Long gene name
  telomeric repeat binding factor 1
• Synonyms gene
  • TRBF1
• Synonyms gene name
  • telomeric repeat binding factor (NIMA-interacting) 1
• Synonyms
  • PIN2
  • TRF1
  • TRF
• GenBank acession
  • U74382
• Locus
  8q21.11
• Discovery year
  1997-11-20
• Entrez gene record
  7013
• Pubmed identfication
  • 9391075
• RefSeq identity
  • NM_017489
• Classification
  • Shelterin complex
  • Myb/SANT domain containing
• VEGA ID
  OTTHUMG00000164522

Gene info

• Identity
  HGNC:55532
• Gene
  PINX1-DT
• Long gene name
  PINX1 divergent transcript
• Locus
  8p23.1
• Discovery year
  2021-03-22
• Entrez gene record
  101929229
• RefSeq identity
  • NR_125432
• Classification
  • Divergent transcripts

Gene info

• Identity
  HGNC:30046
• Gene
  PINX1
• Long gene name
  PIN2 (TERF1) interacting telomerase inhibitor 1
• Synonyms gene name
  • PIN2/TERF1 interacting telomerase inhibitor 1
• Synonyms
  • LPTL
  • LPTS
  • FLJ20565
  • MGC8850
  • Gno1
  • Pxr1
• Synonyms name
  • PIN2 interacting protein 1
  • liver-related putative tumor suppressor
• GenBank acession
  • AF418553
• Locus
  8p23.1
• Discovery year
  2010-04-26
• Entrez gene record
  54984
• Pubmed identfication
  • 11003615
  • 11701125
• RefSeq identity
  • NM_017884
• Classification
  • G-patch domain containing
  • SSU processome
  • MicroRNA protein coding host genes

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products