Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human TERF1 Interacting Telomerase Inhibitor 1 PIN2 PINX1 N 6His

Recombinant Human TERF1 Interacting Telomerase Inhibitor 1 PIN2 PINX1 N 6His is available 4 times from Novo labs

C287-1000 | Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His) size: 1 mg | 2,525.23 USD

Loading

C287-10 | Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His) size: 10 ug | 224.54 USD

Catalog number C287-10
Supplier novo
Price 224.54 USD
Size 10 ug
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C287-50 | Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His) size: 50 ug | 549.73 USD

Loading

C287-500 | Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His) size: 500 ug | 1,785.25 USD

Loading
Description Recombinant Human PINX1 is produced by our E.coli expression system and the target gene encoding Met1-Lys328 is expressed with a 6His tag at the N-terminus.
Species reactivity Human
Origin Escherichia coli
Peptide sequence MGSSHHHHHHSSGLVPRGSHMSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
Estimated molecular weight 39,2 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q96BK5
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Additional description Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme.
Source Recombinants or rec. proteins
Group recombinants
Gene targetTERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 N-6His
Short name Recombinant TERF1-Interacting Telomerase Inhibitor 1/PIN2/PINX1 (N-6His)
Technique Recombinant
Species Human
Alternative name recombinant H. sapiens telomeric repeat binding factor (NIMA-interacting) 1-Interacting Telomerase suppressor 1/PIN2/PINX1 (N-6His)
Alternative technique rec
Alternative to gene target telomeric repeat binding factor (NIMA-interacting) 1, hTRF1-AS and PIN2 and t-TRF1 and TRBF1 and TRF and TRF1, TERF1 and IDBG-25349 and ENSG00000147601 and 7013, DNA binding, nuclei, Terf1 and IDBG-134893 and ENSMUSG00000025925 and 21749, BT.23286 and IDBG-644763 and ENSBTAG00000032982 and 519474
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human TERF1-Interacting Telomerase Inhibitor 1/P
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • TERF1-Interacting
  • Telomerase
  • Inhibitor
  • 1/PIN2/PINX1
  • N-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee