Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

PINX1 Blocking Peptide

PINX1 Blocking Peptide is available 4 times from Fitzgerald labs

33R-2516 | PINX1 Blocking Peptide size: 100 µg | 232.28 USD

Catalog number 33R-2516
Supplier fitzgerald
Price 232.28 USD
Size 100 µg
Area of research DNA & RNA
Residues EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF
1. Gene info
Identity30046
GenePINX1
Synonyms gene name
  • PIN2/TERF1 interacting telomerase inhibitor 1
GenBank acession
Locus8p23
Discovery year2010-04-26
Pubmed identfication
RefSeq identity

33R-2507 | PINX1 Blocking Peptide size: 100 µg | 232.28 USD

Loading

33R-2507 | PINX1 Blocking Peptide size: 100 ug | 309.71 USD

Loading

33R-2516 | PINX1 Blocking Peptide size: 100 ug | 309.71 USD

Loading
Category Proteins
Applications WB, IHC
Tested for WB; IHC
Type of protein Synthetic
Product Subtype Blocking Peptides
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Type1 Synthetic
Antibody Subtype Blocking Peptides
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Shipping Info Blue Ice
Shipping conditions Blue Ice
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetPINX1
Short name PINX1 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name PINX1 inhibiting short protein sequence
Alternative technique control
Similar products
PINX1 Blocking Peptide Suppplier: abbex
Price: 336.25 USD
PINX1 Blocking Peptide Suppplier: MyBioSource
Price: 251.08 USD
Ask
Ajax processing
Close
PINX1 Blocking Peptide sku: 1011951551 - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • PINX1
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee