Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Stem Cell Factor SCF c Kit Ligand

Recombinant Human Stem Cell Factor SCF c Kit Ligand is available 8 times from Novo labs

C034-1000 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand size: 1 mg | 2,038.34 USD

Catalog number C034-1000
Supplier novo
Price 2,038.34 USD
Size 1 mg
Description Recombinant Human Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Glu26-Ala189 is expressed.
Origin Escherichia coli
Peptide sequence MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Estimated molecular weight 18,4 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions See included datasheet or contact us for more information.
Gene targetStem Factor/SCF/c-Kit Ligand
Short name Recombinant Stem Factor/SCF/c-Kit Ligand
Alternative name recombinant H. sapiens progenitor cellular Factor/SCF/c-reagent Ligand
1. Gene info
Identity6343
GeneKITLG
Long gene nameKIT ligand
Synonyms gene
GenBank acession
Discovery year1991-06-04
Pubmed identfication
RefSeq identity
  • NM_003994
Havana BLAST/BLAT OTTHUMG00000169888
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C034-50 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand size: 50 ug | 551.47 USD

Loading

C034-500 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand size: 500 ug | 1,441.37 USD

Loading

C034-10 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand size: 10 ug | 225.25 USD

Loading

CD53-10 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His) size: 10 ug | 163.11 USD

Loading

CD53-50 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His) size: 50 ug | 377.26 USD

Loading

CD53-500 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His) size: 500 ug | 1,790.89 USD

Loading

CD53-1000 | Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His) size: 1 mg | 2,533.22 USD

Loading
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Species reactivity Human
UniProt number P21583
Shipping condition Ambient/Room Temperature
Description For cells, cell lines and tissues in culture till half confluency.Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Test Stem cell factors and stem cell growth factors will produce stem cells or be part of a transdifferentiation process to produce other cells. A cell can transdifferentiate by going back to the naive stem cell stadium or directly into the other cell, helped by the stem cell and transdifferentiationf actors. Stem cell growth factors or stem cell factors are mostly used to produce iPSCs or induced pluripotent stem cells by Jamaka or Thomson factors by using for example 5 Lenti-III-CMV viruses, expressing the Yamanaka iPSC factor set (Oct4, Sox2, Nanog and Lin28) + GFP positive control. Trans differentiation will omit the stem cell stadium but stem cell factors sill play an important role in trans differentiation strategies.
Technique Recombinant
Species Human
Alternative technique rec
Alternative to gene target v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, C-Kit and CD117 and PBT and SCFR, KIT and IDBG-18980 and ENSG00000157404 and 3815, transferase activity, Extracellular, Kit and IDBG-172083 and ENSMUSG00000005672 and 16590, KIT and IDBG-642326 and ENSBTAG00000002699 and 280832
Tissue cell, stem
Similar products
Recombinant Human Stem Cell Factor SCF Protein Suppplier: adv
Price: 505.98 USD
Human Stem Cell Factor Receptor SCFR ELISA Kit Suppplier: abebio
Price: 424.98 USD
Ask
Ajax processing
Close
Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand size: 1
Filters
+32-(0)1-658-90-45 [email protected]
  • Stem
  • Factor/SCF/c-Kit
  • Ligand
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee