Recombinant Human Histone deacetylase 6(HDAC6)

  • Catalog number
    RPC20451
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q9UBN7
  • Gene name
    HDAC6
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    1-488aa
  • Protein sequence
    MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
  • Information about sequence
    Partial
  • Expected molecular weight
    69,68kD
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    HDAC6
  • Short name
    Recombinant Histone deacetylase 6(HDAC6)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Humans
  • Alternative name
    Rec. H. sapiens Histone deacetylase 6(histone deacetylase 6)
  • Alternative technique
    rec
  • Alternative to gene target
    histone deacetylase 6, CPBHM and HD6 and PPP1R90, HDAC6 and IDBG-63929 and ENSG00000094631 and 10013, NAD-dependent histone deacetylase activity (H3-K18 specific), nuclei, Hdac6 and IDBG-129835 and ENSMUSG00000031161 and 15185, BT.76413 and IDBG-636881 and ENSBTAG00000013244 and 513602
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee