SMAD Antibody (SMAD1-5)

  • Catalog number
    R32238
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    SMAD (SMAD1-5)
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the SMAD antibody should be determined by the researcher.
  • Intented use
    This SMAD antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    Q15797
  • Purity
    Antigen affinity
  • Description
    SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4.
  • Immunogen
    Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
  • Storage
    After reconstitution, the SMAD antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Nuclear and cytoplasmic
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    SMAD   SMAD1-5  
  • Gene symbol
    SMAD1-AS2, SMAD1-AS1, SMAD1, GARS1, MIR1302-5, PIRC23, PIRC22, PIRC20, PIRC21, HTR6
  • Short name
    Anti-SMAD (SMAD1-5)
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to SMAD (SMAD1-5)
  • Alternative technique
    antibodies
  • Alternative to gene target
    SMAD family member 1, BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, transforming growth factor beta receptor, nuclei, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    SMAD family member 1
  • Synonyms gene
  • Synonyms gene name
    • MAD, mothers against decapentaplegic homolog 1 (Drosophila)
    • SMAD, mothers against DPP homolog 1 (Drosophila)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-11-15
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • SMAD family
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 23
  • Locus
    5
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 22
  • Locus
    5
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 20
  • Locus
    5
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 21
  • Locus
    5
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
  • Identity
  • Gene
  • Long gene name
    5-hydroxytryptamine receptor 6
  • Synonyms gene name
    • 5-hydroxytryptamine (serotonin) receptor 6
    • 5-hydroxytryptamine (serotonin) receptor 6, G protein-coupled
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1997-12-11
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • 5-hydroxytryptamine receptors, G protein-coupled
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee