Recombinant Human Eukaryotic translation initiation factor 3 subunit M(EIF3M)

• Catalog number
  RPC20375
• Price
  Please ask
• Size
  100 μg

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  Q7L2H7
• Gene number
  EIF3M
• Other name
  Short name:; eIF3m; Alternative name(s):; Fetal lung protein B5; Short name:; hFL-B5; PCI domain-containing protein 1
• Protein origin
  E.coli
• Protein region
  2-374aa
• Protein sequence
  SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
• Information about sequence
  Full Length
• Expected molecular weight
  58.34kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Eukaryotic   translation   initiation   factor   subunit   EIF3M  
• Gene symbol
  EIF3M
• Short name
  Recombinant Eukaryotic translation initiation factor 3 subunit M(EIF3M)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens Eukaryotic translation initiation factor 3 functionnal sequence M(EIF3M)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:24460
• Gene
  EIF3M
• Long gene name
  eukaryotic translation initiation factor 3 subunit M
• Synonyms gene
  • PCID1
• Synonyms gene name
  • PCI domain containing 1 (herpesvirus entry mediator)
  • eukaryotic translation initiation factor 3, subunit M
• Synonyms
  • hfl-B5
  • FLJ29030
  • GA17
  • TANGO7
• Synonyms name
  • transport and golgi organization 7 homolog (Drosophila)
• GenBank acession
  • AK131064
• Locus
  11p13
• Discovery year
  2006-03-31
• Entrez gene record
  10480
• Pubmed identfication
  • 15919898
  • 15919899
• RefSeq identity
  • NM_006360
• Classification
  • Armadillo like helical domain containing
  • Eukaryotic translation initiation factor 3
• VEGA ID
  OTTHUMG00000166258

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products