-
Target antigen
Peroxiredoxin 4
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P,ICC
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Peroxiredoxin 4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Peroxiredoxin 4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.
-
Related articles
1. Jin, D.-Y, Chae, H. Z, Rhee, S. G, Jeang, K.-T. Regulatory role for a novel human thioredoxin peroxidase in NF-kappa-B activation. J. Biol. Chem. 272: 30952-30961, 1997.
-
Gene Name
PRDX4
-
Protein Name
Peroxiredoxin-4
-
Gene Full Name
peroxiredoxin 4
-
Synonyms
Antioxidant enzyme 372 antibody|Antioxidant enzyme AOE372 antibody|AOE37 2 antibody|AOE37-2 antibody|AOE372 antibody|EC 1.11.1.15 antibody|Peroxiredoxin IV antibody|Peroxiredoxin-4 antibody|Peroxiredoxin4 antibody|PRDX 4 antibody|PRDX4 antibody|PRDX4_HUMAN antibody|PRX 4 antibody|Prx IV antibody|Prx-IV antibody|PRX4 antibody|PrxIV antibody|Thioredoxin dependent peroxide reductase A0372 antibody|Thioredoxin Peroxidase (Antioxidant Enzyme) antibody|Thioredoxin peroxidase antibody|Thioredoxin peroxidase AO372 antibody|Thioredoxin-dependent peroxide reductase A0372 antibody|TRANK antibody
-
Uniprot ID
Q13162
-
Entrez GeneID
10549
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps