Blue Fluorescent Protein (BFP)

  • Catalog number
    4994-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    BFP, Blue Fluorescent Protein
  • Alternative_names
    BFP, Blue Fluorescent Protein
  • Description
    Fluorescent protein ideal for subcellular labeling/visualization
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥97%
  • Assay
    SDS-PAGE
  • Purity
    ≥97%
  • Molecular Weight
    29.0 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Freeze Dried
  • Reconstitution Instructions
    Reconstitute with dH₂O to 1 mg/ml
  • Background Information
    The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Properties
    Blue has a wavelength of around 480 nm and will make your sample visible. If your sample is too concentrated you can dissolve it in water.
  • Conjugation
    Blue Substrate
  • Additional description
    Fluorescent microspheres, beads and particles applications including blood flow determination, tracing, fluorimetry, in vivo imaging and calibration of imaging and flow cytometry instruments. Because our fluorescent dyes are incorporated in the bead and not just on the surface, they are relatively immune to photo bleaching and other environmental factors. Spheres are in difference sizes and fluorescences, high intensity, FITC, GFP, red, green, yellow, light yellow, sky blue, blue, orange, deep-red, Nile-red, purple, mcherry. The diameter of the spheres is usually higher than 50nm and in the micrometer um range.
  • Gene target
    Protein   BFP  
  • Gene symbol
    RNF112
  • Short name
    Protein (BFP)
  • Label
    Blue
  • Alternative name
    Blue Fluorescent Protein (BFP)
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee