Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Blue Fluorescent Protein BFP

Blue Fluorescent Protein BFP is available 3 times from Biovision labs

4994-1000 | Blue Fluorescent Protein (BFP) size: 1 mg | 2,595.25 USD

Catalog number 4994-1000
Supplier Biovision
Price 2,595.25 USD
Size 1 mg
1. Gene info
Identity 12968
Gene RNF112
Long gene name ring finger protein 112
Synonyms gene
  • ZNF179
Synonyms gene name
  • zinc finger protein 179
Synonyms
  • BFP
Synonyms name
  • neurolastin
GenBank acession
  • AF054587
Locus 17p11.2
Discovery year 1995-10-17
Entrez gene record 7732
Pubmed identfication
  • 8660987
  • 9806830
  • 26212327
RefSeq identity
  • NM_007148
Classification
  • Ring finger proteins
Havana BLAST/BLAT OTTHUMG00000059601
Product images
    #0#.jpegBlue Fluorescent Protein (BFP)

4994-5000 | Blue Fluorescent Protein (BFP) size: 5 mg | 7,533.41 USD

Loading

4994-100 | Blue Fluorescent Protein (BFP) size: 100 ug | 414.23 USD

Loading
Synonyms BFP, Blue Fluorescent Protein
Alternative_names BFP, Blue Fluorescent Protein
Description Fluorescent protein ideal for subcellular labeling/visualization
Recombinant Yes
Source E. coli
Purity by SDS-PAGE ≥97%
Assay SDS-PAGE
Purity ≥97%
Molecular Weight 29.0 kDa
Storage Temp. -20°C
Shipping Gel pack
Shelf Life 12 months
Appearance Lyophilized protein
Physical form description Freeze Dried
Reconstitution Instructions Reconstitute with dH₂O to 1 mg/ml
Background Information The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
Handling Centrifuge the vial prior to opening.
Usage For Research Use Only! Not to be used in humans
Properties Blue has a wavelength of around 480 nm and will make your sample visible. If your sample is too concentrated you can dissolve it in water.
Conjugation Blue Substrate
Additional description Fluorescent microspheres, beads and particles applications including blood flow determination, tracing, fluorimetry, in vivo imaging and calibration of imaging and flow cytometry instruments. Because our fluorescent dyes are incorporated in the bead and not just on the surface, they are relatively immune to photo bleaching and other environmental factors. Spheres are in difference sizes and fluorescences, high intensity, FITC, GFP, red, green, yellow, light yellow, sky blue, blue, orange, deep-red, Nile-red, purple, mcherry. The diameter of the spheres is usually higher than 50nm and in the micrometer um range.
Gene targetProtein BFP
Short name Protein (BFP)
Label Blue
Alternative name Blue Fluorescent Protein (BFP)
Similar products
FGD3 ELISA KIT|Human Suppplier: Lifescience Market
Price: 830.87 USD
NCRNA00114 antibody Suppplier: MyBioSource
Price: 666.86 USD
Human WD repeat-containing protein 5B, WDR5B ELISA Kit Suppplier: MyBioSource
Price: 640.33 USD
CAPNS1 siRNA (Human) Suppplier: MyBioSource
Price: 546.27 USD
Genprice BPT-517-427, 2 000 Suppplier: Gentaur Genprice
Price: 483.57 USD
Diacylglycerol Kinase Suppplier: Abbexa
Price: 366.59 USD
tert Butyl 4 3 acetylphenyl piperidine 1 carboxylate Suppplier: ChemScene
Price: 321.98 USD
CORO1C 3 UTR Lenti reporter Virus Suppplier: ABM microrna
Price: 11 456.05 USD
Human MutL Homolog 1 ELISA Kit Suppplier: MyBioSource
Price: 6.03 USD
Recombinant Mycobacterium sp Argininosuccinate Suppplier: MyBioSource
Price: 6.03 USD
Rat Cyclin C(CCNC) ELISA kit Suppplier: BlueGen ELISAs
Price: 1 531.49 USD
Streptococcus pneumoniae 50S ribosomal protein L5 rplE Suppplier: MBS Recombinant
Price: 1 899.29 USD
5-(4-BOC-piperazino)-2-nitroanisole Suppplier: SFC
Price: 0.00 USD
Methyl (2E)-3-(4-methylphenyl)propenoate Suppplier: SFC
Price: 0.00 USD
Ask
Ajax processing
Close
Protein (BFP) | Technique alternative | 01012195857
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Protein
  • BFP
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee