CASP7 Blocking Peptide

• Catalog number
  33R-6808
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Differentiation & Development
• Residues
  NNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLL
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  CASP7  
• Gene symbol
  CASP7
• Short name
  CASP7 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of CASP7 antibody, catalog no. 70R-9653
• Alternative technique
  control, peptides
• Alternative to gene target
  caspase 7, apoptosis-related cysteine peptidase, CASP-7 and CMH-1 and ICE-LAP3 and LICE2 and MCH3, CASP7 and IDBG-90066 and ENSG00000165806 and 840, cysteine-type endopeptidase activity involved in apoptotic process, nuclei, Casp7 and IDBG-178813 and ENSMUSG00000025076 and 12369, BT.62821 and IDBG-639904 and ENSBTAG00000006615 and 526279

Gene info

• Identity
  HGNC:1508
• Gene
  CASP7
• Long gene name
  caspase 7
• Synonyms gene name
  • caspase 7, apoptosis-related cysteine protease
  • caspase 7, apoptosis-related cysteine peptidase
• Synonyms
  • MCH3
  • CMH-1
  • ICE-LAP3
• GenBank acession
  • U37448
• Locus
  10q25.3
• Discovery year
  1996-07-22
• Entrez gene record
  840
• Pubmed identfication
  • 8521391
  • 8576161
• RefSeq identity
  • NM_033338
• Classification
  • Caspases
• VEGA ID
  OTTHUMG00000019076

MeSH Data

• Name
  Models, Chemical
• Concept
  Scope note: Theoretical representations that simulate the behavior or activity of chemical processes or phenomena; includes the use of mathematical equations, computers, and other electronic equipment.
• Tree numbers
  • E05.599.495

Similar products