Superoxide Dismutase 2 Antibody / SOD2

  • Catalog number
    R31882
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    Superoxide Dismutase 2 / SOD2
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB, IHC-P
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
  • Notes
    Optimal dilution of the SOD2 antibody should be determined by the researcher.
  • Intented use
    This SOD2 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P04179
  • Purity
    Antigen affinity
  • Description
    SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
  • Immunogen
    Amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK of human SOD2 were used as the immunogen for the SOD2 antibody.
  • Storage
    After reconstitution, the SOD2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Localization
    Cytoplasmic
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    SOD2-OT1, SOD2, GCASPC
  • Short name
    Anti-Superoxide Dismutase 2 / SOD2
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to Superoxide Dismutase 2 / SOD2
  • Alternative technique
    antibodies
  • Alternative to gene target
    superoxide dismutase 2, mitochondrial, IPOB and MNSOD and MVCD6, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518,6648, metal ion binding, Cytoplasm, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496
Gene info
  • Identity
  • Gene
  • Long gene name
    SOD2 overlapping transcript 1
  • Locus
  • Discovery year
    2017-04-19
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Overlapping transcripts
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee