EGF, rat recombinant

  • Catalog number
    4024-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    Urogastrone, URG, EGF, epidermal growth factor
  • Alternative_names
    Urogastrone, URG, EGF, epidermal growth factor
  • Description
    A growth factor stimulating cell growth, proliferation, and differentiation by binding to EGFR
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥98%
  • Assay
    SDS-PAGE
  • Purity
    ≥98%
  • Biological activity
    The ED₅₀ as calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.1ng/ml, corresponding to a specific activity of > 1 x 10⁷units/mg.
  • Molecular Weight
    6.151 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized from PBS, pH 7.4
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer.
  • Background Information
    Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    EGF  
  • Gene symbol
    EGF
  • Short name
    EGF, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    epidermal growth factor, rat Rec.
  • Alternative technique
    rec
  • Alternative to gene target
    epidermal growth factor, HOMG4 and URG, EGF and IDBG-34100 and ENSG00000138798 and 1950, transmembrane receptor protein tyrosine kinase activator activity, Extracellular, Egf and IDBG-193432 and ENSMUSG00000028017 and 13645
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee