Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Irf2bp1 Blocking Peptide

Irf2bp1 Blocking Peptide is available 0 time from Fitzgerald labs

Residues ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Research Area Signal Transduction
Type of protein Synthetic
Tag/Conjugate ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Signal Transduction
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetIrf2bp1
Short name Irf2bp1 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name interferon regulatory factor 2 binding protein 1 inhibiting short protein sequence
Alternative technique control
Alternative to gene target interferon regulatory factor 2 binding protein 1, IRF2BP1 and IDBG-58309 and ENSG00000170604 and 26145, metal ion binding, nuclei, Irf2bp1 and IDBG-149056 and ENSMUSG00000044030 and 272359, IRF2BP1 and IDBG-647707 and ENSBTAG00000000154 and 523963
Similar products
Ask
Ajax processing
Close
Irf2bp1 Blocking Peptide - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee