Human CellExp™ Cathepsin S, human recombinant

  • Catalog number
    7277-50
  • Price
    Please ask
  • Size
    50 ug
  • Synonyms
    Cathepsin S, CTSS
  • Alternative_names
    Cathepsin S, CTSS
  • Description
    A lysosomal cysteine protease participating in the degradation of antigenic proteins to peptides
  • Recombinant
    Yes
  • Source
    HEK 293 cells
  • Purity by SDS PAGE
    ≥95%
  • Assay
    SDS-PAGE
  • Purity
    ≥95%
  • Activity Specifications test method
    >1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
  • Biological activity
    >1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).
  • Results
    >1000 mU (1U = 1 µmole/min/mg) .
  • Molecular Weight
    ~ 37 kDa
  • Storage Temp
    -80°C
  • Shipping
    Dry Ice
  • Shelf Life
    6 months
  • Concentration
    0.2 uM
  • Appearance
    Liquid
  • Physical form description
    A 0.2 uM filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.
  • Background Information
    Cathepsin S (CTSS) is a lysosomal cysteine protease of the papain family and may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. CTSS is synthesized as inactive precursor of 331 amino acids consisting of a 15-aa signal peptide, a propeptide of 99 aa, and a mature polypeptide of 217 aa. It is activated in the lysosomes by a proteolytic cleavage of the propeptide. The deduced amino acid sequence contains only one potential N-glycosylation site located in the propeptide. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer’s disease (AD) and Down Syndrome (DS).
  • Amino acid sequence
    QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Gene
    CTS protease activity also measured by zymograph electrophoresis of Cathepsins. This cathepsin is supplied in 1.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    CellExp™ Cathepsin S, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Humans
  • Alternative name
    H. sapiens CellExp™ Cathepsin S, H. sapiens Rec.
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee