-
Stock availability
In Stock
-
Scientific context
Rab5 is a 24kDa member of the Rab family of small guanosine triphosphatases (GTPases), Ras superfamily. Rab GTPases are central regulators of membrane trafficking in the eukaryotic cell. Their regulatory capacity depends on their ability to cycle between the GDP -bound inactive and GTP-bound active states. This conversion is regulated by GDP/GTP exchange factors (GEPs), GDP dissociation inhibitors (GDIs) and GTPase-activating proteins (GAPs) (1, 2). Activation of a Rab protein is coupled to its association with intracellular membranes, allowing it to recruit downstream effector proteins to the cytoplasmic surface of a subcellular compartment (3). Through these proteins, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion(1). Rab proteins contain conserved regions involved in guanine-nucleotide binding, and hyper variable COHO-terminal domains with a cysteine motif implicated in subcellular targeting. Post-translational modification of the cysteine motif with one or two geranyl groups is essential for the membrane association and correct intracellular localization of Rab proteins(3). Each Rab shows a characteristic subcellular distribution (4). In particular, Rab5 is ubiquitously expressed in human tissues. It localizes mainly to early endosomes, but is also present on the plasma membrane. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes (5). Among the proteins recruited by the GTP-bound active Rab5 are Rabaptin-5 and EEA1 (6). Anti-Rab5 may be used as an early endosome marker.
-
Protein target
Rab5
-
Protein reactivity
Human
-
Certificate of analysis
This product has been certified >90% pure using SDS-PAGE analysis.
-
Protein description
Human Recombinant Rab5 Protein
-
Other name
Rab 5A Protein, RAS associated protein RAB5A Protein, Ras related protein Rab 5 A Protein
-
Primary research area
Cancer, Heat Shock
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
BC001267
-
Gene number
5868
-
Protein number
P20339
-
Verified applications
WB, SDS-PAGE
-
Relevant bio activity
Rab5 Protein
-
Protein expression model
E. coli
-
Protein charasterics
See included datasheet.
-
Peptide sequence
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
-
Protein purification
Affinity Purified
-
Purity pourcentage
>90% High purity
-
Recommended buffer for storage
20mM Tris/HCl, pH7.5, 0.15M NaCl
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~26 kDa
-
Protein tag
His tag
-
Storage recommendations
-20°C
-
Shipping recommendations
Blue Ice or 4°C
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Cell Membrane, Early Endosome Membrane, Melanosome
-
Bibliography
1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.
-
Release date
20-May-2009
-
PubMed number
Not added. Please refer to PubMed
-
Tested applications
to be tested
-
Tested species reactivity
to be tested
-
-
Representative figure legend
SDS-PAGE of 26kDa human Rab5 protein (SPR-121). SDS-Page of human RAB5 Protein (SPR-121)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.1
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants