Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Human Recombinant Rab5 Protein

Human Recombinant Rab5 Protein is available 3 times from Stressmark proteins labs

SPR-121B | Human Recombinant Rab5 Protein size: 100 µg | 941.55 USD

Catalog number SPR-121B
Price 941.55 USD
Size 100 µg
Recommended buffer for storage 20mM Tris/HCl, pH7.5, 0.15M NaCl
Net weight (g) 0.1
1. Gene info
Identity 9783
Gene RAB5A
Long gene name RAB5A, member RAS oncogene family
Synonyms gene
  • RAB5
Synonyms name
  • RAS-associated protein RAB5A
Locus 3p24.3
Discovery year 1990-01-22
Entrez gene record 5868
Pubmed identfication
  • 1999336
RefSeq identity
  • NM_004162
Classification
  • RAB, member RAS oncogene GTPases
Havana BLAST/BLAT OTTHUMG00000129889
Product images
    #Human#.jpg

SPR-121A | Human Recombinant Rab5 Protein size: 50 µg | 533.35 USD

Loading

SPR-121C | Human Recombinant Rab5 Protein size: 2x100 µg | 1,648.55 USD

Loading
Stock availability In Stock
Scientific context Rab5 is a 24kDa member of the Rab family of small guanosine triphosphatases (GTPases), Ras superfamily. Rab GTPases are central regulators of membrane trafficking in the eukaryotic cell. Their regulatory capacity depends on their ability to cycle between the GDP -bound inactive and GTP-bound active states. This conversion is regulated by GDP/GTP exchange factors (GEPs), GDP dissociation inhibitors (GDIs) and GTPase-activating proteins (GAPs) (1, 2). Activation of a Rab protein is coupled to its association with intracellular membranes, allowing it to recruit downstream effector proteins to the cytoplasmic surface of a subcellular compartment (3). Through these proteins, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion(1). Rab proteins contain conserved regions involved in guanine-nucleotide binding, and hyper variable COHO-terminal domains with a cysteine motif implicated in subcellular targeting. Post-translational modification of the cysteine motif with one or two geranyl groups is essential for the membrane association and correct intracellular localization of Rab proteins(3). Each Rab shows a characteristic subcellular distribution (4). In particular, Rab5 is ubiquitously expressed in human tissues. It localizes mainly to early endosomes, but is also present on the plasma membrane. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes (5). Among the proteins recruited by the GTP-bound active Rab5 are Rabaptin-5 and EEA1 (6). Anti-Rab5 may be used as an early endosome marker.
Protein target Rab5
Protein reactivity Human
Certificate of analysis This product has been certified >90% pure using SDS-PAGE analysis.
Protein description Human Recombinant Rab5 Protein
Other name Rab 5A Protein, RAS associated protein RAB5A Protein, Ras related protein Rab 5 A Protein
Primary research area Cancer, Heat Shock
Category Protein
Brand name none
Origin Recombinant
NCBI number BC001267
Gene number 5868
Protein number P20339
Verified applications WB, SDS-PAGE
Relevant bio activity Rab5 Protein
Protein expression model E. coli
Protein charasterics See included datasheet.
Peptide sequence MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Protein purification Affinity Purified
Purity pourcentage >90% High purity
Protein concentration Lot/batch specific. See included datasheet.
Protein specificity ~26 kDa
Protein tag His tag
Storage recommendations -20°C
Shipping recommendations Blue Ice or 4°C
Supplementary useful information Please see included datasheet or contact us
Protein cell localization Cell Membrane, Early Endosome Membrane, Melanosome
Bibliography 1. Stenmark H., and Olkkonen V.M. (2001) Genome Biol. 2: 3007.1-3007.7. 2. Takai Y., et al. (2001) Physiol. Rev. 8:, 153-208. 3. Ali B.R., et al. (2004) J. Cell Sci. 117: 6401-6412. 4. Zerial M., and McBride H. (2001) Nat. Rev. Mol. Cell Biol. 2: 107-117. 5. Sonnichsen B., et al. (2000) J. Cell Biol. 149: 901-913 6. Woodman P.G. (2000) Traffic. 1: 695-701.
Release date 20-May-2009
PubMed number Not added. Please refer to PubMed
Tested applications to be tested
Tested species reactivity to be tested
Representative figure legend SDS-PAGE of 26kDa human Rab5 protein (SPR-121). SDS-Page of human RAB5 Protein (SPR-121)
Warnings Non-hazardous materials
Protein origin Canada
Total weight (kg) 1.4
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetRab5 Protein
Short name Recombinant Rab5 Protein
Technique Recombinant
Species Human
Alternative name H. sapiens recombinant Rab5 Protein
Alternative technique rec
Similar products
Acrylate PEG NHS type A NHS SCM Suppplier: abbex
Price: 881.78 USD
Assay kit for Canine IgLON family member 5 IGLON5 ELISA Suppplier: BlueGen ELISAs
Price: 682.20 USD
pET28a-IL18 Suppplier: Lifescience Market
Price: 675.43 USD
Human DNMT2 DNA Methyltransferase 2 Kit Suppplier: Elabscience
Price: 554.78 USD
WIPF1 Polyclonal Primary Antibody Suppplier: EnoGene
Price: 422.85 USD
MRPL14 Antibody Suppplier: SAB
Price: 382.26 USD
Histone H3 Mono Methyl Lys37 Polyclonal Antibody Suppplier: MyBioSource
Price: 305.58 USD
CIDEC Antibody Suppplier: Bioss Primary Unconjugated Antibodies
Price: 296.56 USD
4-Hydroxy-2-Hexenal (4-HHE) Suppplier: immunodiagnostic new
Price: 276.26 USD
Cetilistat Suppplier: trca
Price: 129.67 USD
MEF2C siRNA Mouse Suppplier: MyBioSource
Price: 5.64 USD
Human C4orf23 CRISPR Knock Out Cell Line Suppplier: ABM CrispR
Price: 6 563.76 USD
Rat visfatin ELISA Kit Suppplier: Biomatik
Price: 1 134.37 USD
Haemophilus parasuis serovar 5 DNA Suppplier: MBS Recombinant
Price: 1 520.00 USD
Monkey Copine 8(CPNE8) ELISA kit Suppplier: BlueGen ELISAs
Price: 1 432.05 USD
Ddx46 3 UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Octylthioglucoside Suppplier: SFC
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Rab5 Protein | Technique alternative | 010125122
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Rab5
  • Protein
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee