Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Bordetella pertussis Pertactin autotransporter prn

Recombinant Bordetella pertussis Pertactin autotransporter prn is available 6 times from Bioma labs

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 1 mg | 1,763.06 USD

Loading

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 10 μg | 181.93 USD

Loading

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 200 μg | 767.41 USD

Loading

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 500 μg | 1,188.60 USD

Loading

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 50 μg | 345.11 USD

Catalog number RPC20111
Supplier bioma
Price 345.11 USD
Size 50 μg
Expected molecular weight 45.8kDa
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500

RPC20111 | Recombinant Bordetella pertussis Pertactin autotransporter(prn) size: 100 μg | 510.50 USD

Loading
Other name P.93
Protein origin E.coli
Estimated production time 7-11 business days
Gene number prn
Gene name prn
Protein number P14283
Protein sequence ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW
Notes For research use only. Not for diagnostic procedures.
Use before 1 year
Information about sequence Full Length
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Shipping requirements Blue ice
Verified reactivity Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Protein purity ≥ 90%
Protein region 632-910aa
Source Recombinants or rec. proteins
Group recombinants
Gene targetBordetella pertussis Pertactin autotransporter(prn
Short name Recombinant Bordetella pertussis Pertactin autotransporter(prn)
Technique Recombinant
Alternative name recombinant Bordetella pertussis Pertactin autotransporter(prn)
Alternative technique rec
Disease bordetella
Similar products
Recombinant Bordetella pertussis 7 7 deazaguanine synthase Suppplier: MyBioSource
Price: 798.28 USD
Recombinant Bordetella pertussis Molybdenum Suppplier: MyBioSource
Price: 737.64 USD
Rabbit Anti Bordetella pertussis prn Antibody Suppplier: Cusabio
Price: 233.75 USD
Recombinant Bordetella pertussis Argininosuccinate Suppplier: MyBioSource
Price: 1 102.60 USD
Recombinant Bordetella pertussis Serine Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Bordetella pertussis Urease Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Bordetella pertussis Glycerol Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Bordetella pertussis Virulence Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Bordetella pertussis 3 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Pertactin autotransporter prn Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Bordetella pertussis Suppplier: Biomatik
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Bordetella pertussis Pertactin autotransporter(p
Filters
+32-(0)1-658-90-45 [email protected]
  • Bordetella
  • pertussis
  • Pertactin
  • autotransporter(prn
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee